cAMP-dependent protein kinase inhibitor alpha

Details

Name
cAMP-dependent protein kinase inhibitor alpha
Synonyms
  • cAMP-dependent protein kinase inhibitor, muscle/brain isoform
  • PKI-alpha
  • PRKACN1
Gene Name
PKIA
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012626|cAMP-dependent protein kinase inhibitor alpha
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSS
TEQSGEAQGEAAKSES
Number of residues
76
Molecular Weight
7988.435
Theoretical pI
4.18
GO Classification
Functions
cAMP-dependent protein kinase inhibitor activity / protein kinase A catalytic subunit binding
Processes
negative regulation of cAMP-dependent protein kinase activity / negative regulation of protein import into nucleus / negative regulation of transcription from RNA polymerase II promoter / regulation of G2/M transition of mitotic cell cycle
Components
cytoplasm / nucleus
General Function
Protein kinase a catalytic subunit binding
Specific Function
Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012627|cAMP-dependent protein kinase inhibitor alpha (PKIA)
ATGACTGATGTGGAAACTACATATGCAGATTTTATTGCTTCAGGAAGAACAGGTAGAAGA
AATGCAATACATGATATCCTGGTTTCCTCTGCAAGTGGCAACAGCAATGAATTAGCCTTG
AAATTAGCAGGTCTTGATATCAACAAGACAGAAGGTGAAGAAGATGCACAACGAAGTTCT
ACAGAACAAAGTGGGGAAGCCCAGGGAGAAGCAGCAAAATCTGAAAGCTAA
Chromosome Location
8
Locus
8q21.12
External Identifiers
ResourceLink
UniProtKB IDP61925
UniProtKB Entry NameIPKA_HUMAN
GenBank Protein ID243494
GenBank Gene IDS76965
HGNC IDHGNC:9017
General References
  1. Olsen SR, Uhler MD: Inhibition of protein kinase-A by overexpression of the cloned human protein kinase inhibitor. Mol Endocrinol. 1991 Sep;5(9):1246-56. [PubMed:1770951]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [PubMed:22814378]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06959(2S)-1-(3H-Indol-3-yl)-3-{[5-(6-isoquinolinyl)-3-pyridinyl]oxy}-2-propanamineexperimentalunknownDetails
DB07107(1S)-2-(1H-INDOL-3-YL)-1-[({5-[(E)-2-PYRIDIN-4-YLVINYL]PYRIDIN-3-YL}OXY)METHYL]ETHYLAMINEexperimentalunknownDetails
DB07204(1S)-1-(1H-INDOL-3-YLMETHYL)-2-(2-PYRIDIN-4-YL-[1,7]NAPHTYRIDIN-5-YLOXY)-EHYLAMINEexperimentalunknownDetails
DB07583(4R,2S)-5'-(4-(4-CHLOROBENZYLOXY)PYRROLIDIN-2-YLMETHANESULFONYL)ISOQUINOLINEexperimentalunknownDetails
DB07854N-METHYL-1-[4-(9H-PURIN-6-YL)PHENYL]METHANAMINEexperimentalunknownDetails
DB07855(S)-1-PHENYL-1-[4-(9H-PURIN-6-YL)PHENYL]METHANAMINEexperimentalunknownDetails
DB078566-{4-[4-(4-CHLOROPHENYL)PIPERIDIN-4-YL]PHENYL}-9H-PURINEexperimentalunknownDetails
DB07857(2R)-2-(4-chlorophenyl)-2-[4-(1H-pyrazol-4-yl)phenyl]ethanamineexperimentalunknownDetails
DB07858(2S)-2-(4-chlorophenyl)-2-[4-(1H-pyrazol-4-yl)phenyl]ethanamineexperimentalunknownDetails
DB078594-(4-CHLOROPHENYL)-4-[4-(1H-PYRAZOL-4-YL)PHENYL]PIPERIDINEexperimentalunknownDetails
DB07860(2R)-2-(4-CHLOROPHENYL)-2-PHENYLETHANAMINEexperimentalunknownDetails
DB07876(S)-2-METHYL-1-[(4-METHYL-5-ISOQUINOLINE)SULFONYL]-HOMOPIPERAZINEexperimentalunknownDetails
DB04707HydroxyfasudilexperimentalunknownDetails
DB07947ISOQUINOLINE-5-SULFONIC ACID (2-(2-(4-CHLOROBENZYLOXY)ETHYLAMINO)ETHYL)AMIDEexperimentalunknownDetails
DB07995N-[2-(4-BROMOCINNAMYLAMINO)ETHYL]-5-ISOQUINOLINE SULFONAMIDEexperimentalunknownDetails
DB079965-(2-methylpiperazine-1-sulfonyl)isoquinolineexperimentalunknownDetails
DB07997N-[2-(METHYLAMINO)ETHYL]-5-ISOQUINOLINESULFONAMIDEexperimentalunknownDetails
DB080702-[4-(3-METHYL-1H-PYRAZOL-4-YL)PHENYL]ETHANAMINEexperimentalunknownDetails
DB08073(2S)-1-(1H-INDOL-3-YL)-3-{[5-(3-METHYL-1H-INDAZOL-5-YL)PYRIDIN-3-YL]OXY}PROPAN-2-AMINEexperimentalunknownDetails
DB081133-pyridin-4-yl-1H-indazoleexperimentalunknownDetails
DB081145-benzyl-1,3-thiazol-2-amineexperimentalunknownDetails
DB081481-[4-(4-chlorophenyl)-1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)piperidin-4-yl]methanamineexperimentalunknownDetails
DB081491-[4-(4-chlorobenzyl)-1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)piperidin-4-yl]methanamineexperimentalunknownDetails
DB081504-(4-chlorobenzyl)-1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)piperidin-4-aminiumexperimentalunknownDetails
DB08162FasudilinvestigationalunknownDetails
DB08231Myristic acidexperimentalunknownDetails
DB08568(2S)-1-{[5-(3-METHYL-1H-INDAZOL-5-YL)PYRIDIN-3-YL]OXY}-3-PHENYLPROPAN-2-AMINEexperimentalunknownDetails
DB085693-PYRIDIN-4-YL-2,4-DIHYDRO-INDENO[1,2-.C.] PYRAZOLEexperimentalunknownDetails
DB033743,5-DiiodotyrosineexperimentalunknownDetails
DB08756(R)-TRANS-4-(1-AMINOETHYL)-N-(4-PYRIDYL) CYCLOHEXANECARBOXAMIDEexperimentalunknownDetails