Voltage-dependent calcium channel gamma-7 subunit
Details
- Name
- Voltage-dependent calcium channel gamma-7 subunit
- Synonyms
- Neuronal voltage-gated calcium channel gamma-7 subunit
- TARP gamma-7
- Transmembrane AMPAR regulatory protein gamma-7
- Gene Name
- CACNG7
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0051560|Voltage-dependent calcium channel gamma-7 subunit MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
- Number of residues
- 275
- Molecular Weight
- 31002.29
- Theoretical pI
- Not Available
- GO Classification
- Functionschannel regulator activity / voltage-gated calcium channel activityProcessescalcium ion transmembrane transport / calcium ion transport / cardiac conduction / regulation of AMPA receptor activity / transmission of nerve impulseComponentsAMPA glutamate receptor complex / plasma membrane / voltage-gated calcium channel complex
- General Function
- Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Displays subunit-specific AMPA receptor regulation. Shows specificity only for GRIA1 and GRIA2. Thought to stabilize the calcium channel in an inactivated (closed) state.
- Specific Function
- Channel regulator activity
- Pfam Domain Function
- Claudin_2 (PF13903)
- Transmembrane Regions
- 8-28 103-123 129-149 179-199
- Cellular Location
- Membrane
- Gene sequence
>lcl|BSEQ0051561|Voltage-dependent calcium channel gamma-7 subunit (CACNG7) ATGAGTCACTGCAGCAGCCGCGCCCTGACCCTGCTGAGCAGCGTGTTTGGTGCGTGTGGC CTGCTCCTGGTAGGCATCGCGGTCAGCACTGACTACTGGCTGTACATGGAAGAAGGCACA GTGCTACCGCAGAACCAGACCACCGAGGTCAAGATGGCCCTGCACGCCGGCCTCTGGCGA GTCTGCTTCTTTGCAGGTCGGGAGAAAGGTCGCTGTGTGGCCTCAGAATATTTTCTTGAA CCGGAGATCAATTTGGTGACGGAAAACACGGAGAATATTCTGAAGACAGTGCGCACGGCC ACCCCCTTCCCCATGGTCAGCCTCTTCCTCGTGTTCACGGCCTTCGTCATCAGCAACATC GGCCACATCCGCCCGCAGAGGACCATTCTGGCTTTTGTCTCTGGCATCTTCTTCATACTA TCGGGCCTCTCCTTGGTGGTGGGCTTGGTTCTTTACATCTCCAGCATCAACGACGAGGTC ATGAACAGGCCCAGCAGCTCTGAGCAGTATTTTCATTATCGCTACGGGTGGTCTTTTGCC TTCGCCGCTTCCTCCTTCCTACTCAAAGAGGGGGCCGGCGTGATGTCCGTGTACCTGTTC ACCAAGCGCTACGCGGAGGAGGAGATGTACCGTCCACACCCGGCCTTCTACCGCCCGCGT CTCAGCGACTGCTCCGACTACTCGGGCCAGTTCCTGCAGCCCGAGGCGTGGCGCCGCGGC CGGAGCCCCTCCGACATCTCCAGCGACGTGTCCATCCAAATGACGCAGAACTACCCTCCC GCCATCAAGTACCCGGACCACCTGCACATCTCCACCTCGCCCTGCTGA
- Chromosome Location
- 19
- Locus
- 19q13.42
- External Identifiers
Resource Link UniProtKB ID P62955 UniProtKB Entry Name CCG7_HUMAN HGNC ID HGNC:13626 - General References
- Burgess DL, Gefrides LA, Foreman PJ, Noebels JL: A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family. Genomics. 2001 Feb 1;71(3):339-50. [Article]
- Chu PJ, Robertson HM, Best PM: Calcium channel gamma subunits provide insights into the evolution of this gene family. Gene. 2001 Dec 12;280(1-2):37-48. [Article]
- Moss FJ, Viard P, Davies A, Bertaso F, Page KM, Graham A, Canti C, Plumpton M, Plumpton C, Clare JJ, Dolphin AC: The novel product of a five-exon stargazin-related gene abolishes Ca(V)2.2 calcium channel expression. EMBO J. 2002 Apr 2;21(7):1514-23. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Kato AS, Gill MB, Ho MT, Yu H, Tu Y, Siuda ER, Wang H, Qian YW, Nisenbaum ES, Tomita S, Bredt DS: Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins. Neuron. 2010 Dec 22;68(6):1082-96. doi: 10.1016/j.neuron.2010.11.026. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB11148 Butamben approved, withdrawn yes inhibitor Details DB13746 Bioallethrin approved, experimental unknown agonist Details DB00153 Ergocalciferol approved, nutraceutical no inducer Details DB00228 Enflurane approved, investigational, vet_approved yes inhibitoractivator Details DB00661 Verapamil approved unknown inhibitor Details DB00622 Nicardipine approved, investigational unknown inhibitor Details DB09235 Efonidipine experimental yes inhibitor Details