Thioredoxin reductase

Details

Name
Thioredoxin reductase
Synonyms
  • 1.8.1.9
  • TRXR
Gene Name
trxB
Organism
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Amino acid sequence
>lcl|BSEQ0016103|Thioredoxin reductase
MTEIDFDIAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMANTEEVENFPGFEMITG
PDLSTKMFEHAKKFGAVYQYGDIKSVEDKGEYKVINFGNKELTAKAVIIATGAEYKKIGV
PGEQELGGRGVSYCAVCDGAFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR
AQRILQDRAFKNDKIDFIWSHTLKSINEKDGKVGSVTLTSTKDGSEETHEADGVFIYIGM
KPLTAPFKDLGITNDVGYIVTKDDMTTSVPGIFAAGDVRDKGLRQIVTATGDGSIAAQSA
AEYIEHLNDQA
Number of residues
311
Molecular Weight
33615.84
Theoretical pI
5.0
GO Classification
Functions
thioredoxin-disulfide reductase activity
Processes
removal of superoxide radicals
Components
cytoplasm
General Function
Thioredoxin-disulfide reductase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0016104|Thioredoxin reductase (trxB)
ATGACTGAAATAGATTTTGATATAGCAATTATCGGTGCAGGTCCAGCTGGTATGACTGCT
GCAGTATACGCATCACGTGCTAATTTAAAAACAGTTATGATTGAAAGAGGTATTCCAGGC
GGTCAAATGGCTAATACAGAAGAAGTAGAGAACTTCCCTGGTTTCGAAATGATTACAGGT
CCAGATTTATCTACAAAAATGTTTGAACACGCTAAAAAGTTTGGTGCAGTTTATCAATAT
GGAGATATTAAATCTGTAGAAGATAAAGGCGAATATAAAGTGATTAACTTTGGTAATAAA
GAATTAACAGCGAAAGCGGTCATTATTGCTACAGGTGCAGAATACAAGAAAATTGGTGTT
CCGGGTGAACAAGAACTTGGTGGACGCGGTGTAAGTTATTGTGCAGTATGTGATGGTGCA
TTCTTTAAAAATAAACGCCTATTCGTTATCGGTGGTGGTGACTCAGCAGTAGAAGAGGGA
ACATTCTTAACTAAATTTGCTGACAAAGTAACAATCGTTCACCGTCGTGATGAGTTACGT
GCACAGCGTATTTTACAAGATAGAGCATTCAAAAATGATAAAATCGACTTTATTTGGAGT
CATACTTTGAAATCAATTAATGAAAAAGACGGCAAAGTGGGTTCTGTGACATTAACGTCT
ACAAAAGATGGTTCAGAAGAAACACACGAGGCTGATGGTGTATTCATCTATATTGGTATG
AAACCATTAACAGCGCCATTTAAAGACTTAGGTATTACGAATGATGTTGGTTATATTGTG
ACAAAAGATGATATGACAACATCAGTACCAGGTATTTTTGCAGCAGGAGATGTTCGTGAC
AAAGGTTTACGCCAAATTGTCACTGCTACTGGCGATGGTAGTATTGCAGCGCAAAGTGCA
GCGGAATATATTGAACATTTAAACGATCAAGCTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP66010
UniProtKB Entry NameTRXB_STAAM
GenBank Protein ID14246533
GenBank Gene IDBA000017
General References
  1. Kuroda M, Ohta T, Uchiyama I, Baba T, Yuzawa H, Kobayashi I, Cui L, Oguchi A, Aoki K, Nagai Y, Lian J, Ito T, Kanamori M, Matsumaru H, Maruyama A, Murakami H, Hosoyama A, Mizutani-Ui Y, Takahashi NK, Sawano T, Inoue R, Kaito C, Sekimizu K, Hirakawa H, Kuhara S, Goto S, Yabuzaki J, Kanehisa M, Yamashita A, Oshima K, Furuya K, Yoshino C, Shiba T, Hattori M, Ogasawara N, Hayashi H, Hiramatsu K: Whole genome sequencing of meticillin-resistant Staphylococcus aureus. Lancet. 2001 Apr 21;357(9264):1225-40. [PubMed:11418146]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00548Azelaic acidapprovedyesinhibitorDetails