Free methionine-R-sulfoxide reductase

Details

Name
Free methionine-R-sulfoxide reductase
Synonyms
  • 1.8.4.14
  • fRMsr
  • yebR
Gene Name
msrC
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0037222|Free methionine-R-sulfoxide reductase
MNKTEFYADLNRDFNALMAGETSFLATLANTSALLYERLTDINWAGFYLLEDDTLVLGPF
QGKIACVRIPVGRGVCGTAVARNQVQRIEDVHVFDGHIACDAASNSEIVLPLVVKNQIIG
VLDIDSTVFGRFTDEDEQGLRQLVAQLEKVLATTDYKKFFASVAG
Number of residues
165
Molecular Weight
18121.45
Theoretical pI
4.45
GO Classification
Functions
L-methionine-(R)-S-oxide reductase activity / oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
Processes
response to oxidative stress
Components
cytosol
General Function
Oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
Specific Function
Catalyzes the reversible oxidation-reduction of the R-enantiomer of free methionine sulfoxide to methionine. Specific for free L-methionine-(R)-S-oxide.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012222|Free methionine-R-sulfoxide reductase (msrC)
ATGCTTATTTTAATAGGCTGGCAGATCCAGGTAAGACAACCAAGTGATTATATAATGAAC
AAAACAGAATTTTACGCGGATTTAAATCGCGACTTTAACGCGCTGATGGCGGGAGAAACC
AGTTTTCTGGCAACGCTTGCGAACACCAGTGCGTTGTTATATGAGCGTCTCACTGACATA
AACTGGGCAGGTTTTTATTTGCTTGAGGACGATACACTGGTACTCGGACCATTTCAGGGC
AAAATTGCCTGTGTCCGGATACCCGTCGGGCGCGGCGTGTGCGGCACTGCGGTTGCCCGC
AATCAAGTGCAGCGTATCGAGGATGTTCATGTGTTTGACGGGCATATTGCCTGTGATGCG
GCGAGTAATTCTGAAATTGTTCTGCCGCTGGTGGTGAAAAATCAGATTATTGGTGTTCTC
GACATCGATAGTACCGTCTTCGGTCGCTTTACAGACGAGGACGAGCAAGGCTTACGTCAG
CTTGTGGCACAGCTTGAAAAAGTGCTTGCAACGACGGATTACAAAAAATTCTTTGCGAGC
GTCGCAGGATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP76270
UniProtKB Entry NameMSRC_ECOLI
GenBank Gene IDU00096
General References
  1. Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al.: A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):379-92. [PubMed:9097040]
  2. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  3. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  4. Fountoulakis M, Takacs MF, Berndt P, Langen H, Takacs B: Enrichment of low abundance proteins of Escherichia coli by hydroxyapatite chromatography. Electrophoresis. 1999 Aug;20(11):2181-95. [PubMed:10493123]
  5. Lin Z, Johnson LC, Weissbach H, Brot N, Lively MO, Lowther WT: Free methionine-(R)-sulfoxide reductase from Escherichia coli reveals a new GAF domain function. Proc Natl Acad Sci U S A. 2007 Jun 5;104(23):9597-602. Epub 2007 May 29. [PubMed:17535911]
  6. Badger J, Sauder JM, Adams JM, Antonysamy S, Bain K, Bergseid MG, Buchanan SG, Buchanan MD, Batiyenko Y, Christopher JA, Emtage S, Eroshkina A, Feil I, Furlong EB, Gajiwala KS, Gao X, He D, Hendle J, Huber A, Hoda K, Kearins P, Kissinger C, Laubert B, Lewis HA, Lin J, Loomis K, Lorimer D, Louie G, Maletic M, Marsh CD, Miller I, Molinari J, Muller-Dieckmann HJ, Newman JM, Noland BW, Pagarigan B, Park F, Peat TS, Post KW, Radojicic S, Ramos A, Romero R, Rutter ME, Sanderson WE, Schwinn KD, Tresser J, Winhoven J, Wright TA, Wu L, Xu J, Harris TJ: Structural analysis of a set of proteins resulting from a bacterial genomics project. Proteins. 2005 Sep 1;60(4):787-96. [PubMed:16021622]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB038142-(N-Morpholino)-Ethanesulfonic AcidexperimentalunknownDetails