Microtubule-associated protein 1A

Details

Name
Microtubule-associated protein 1A
Synonyms
  • MAP-1A
  • MAP1L
  • Proliferation-related protein p80
Gene Name
MAP1A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0021971|Microtubule-associated protein 1A
MDGVAEFSEYVSETVDVPSPFDLLEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNI
LVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSY
SDWVKNLISPELGVVFFNVPEKLRLPDASRKAKRSIEEACLTLQHLNRLGIQAEPLYRVV
SNTIEPLTLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLPNGKEAEIS
VPYLTSITALVVWLPANPTEKIVRVLFPGNAPQNKILEGLEKLRHLDFLRYPVATQKDLA
SGAVPTNLKPSKIKQRADSKESLKATTKTAVSKLAKREEVVEEGAKEARSELAKELAKTE
KKAKESSEKPPEKPAKPERVKTESSEALKAEKRKLIKDKVGKKHLKEKISKLEEKKDKEK
KEIKKERKELKKDEGRKEEKKDAKKEEKRKDTKPELKKISKPDLKPFTPEVRKTLYKAKV
PGRVKIDRSRAIRGEKELSSEPQTPPAQKGTVPLPTISGHRELVLSSPEDLTQDFEEMKR
EERALLAEQRDTGLGDKPFPLDTAEEGPPSTAIQGTPPSVPGLGQEEHVMKEKELVPEVP
EEQGSKDRGLDSGAETEEEKDTWEEKKQREAERLPDRTEAREESEPEVKEDVIEKAELEE
MEEVHPSDEEEEDATKAEGFYQKHMQEPLKVTPRSREAFGGRELGLQGKAPEKETSLFLS
SLTTPAGATEHVSYIQDETIPGYSETEQTISDEEIHDEPEERPAPPRFHTSTYDLPGPEG
AGPFEASQPADSAVPATSGKVYGTPETELTYPTNIVAAPLAEEEHVSSATSITECDKLSS
FATSVAEDQSVASLTAPQTEETGKSSLLLDTVTSIPSSRTEATQGLDYVPSAGTISPTSS
LEEDKGFKSPPCEDFSVTGESEKRGEIIGKGLSGERAVEEEEEETANVEMSEKLCSQYGT
PVFSAPGHALHPGEPALGEAEERCLSPDDSTVKMASPPPSGPPSATHTPFHQSPVEEKSE
PQDFQEADSWGDTKRTPGVGKEDAAEETVKPGPEEGTLEKEEKVPPPRSPQAQEAPVNID
EGLTGCTIQLLPAQDKAIVFEIMEAGEPTGPILGAEALPGGLRTLPQEPGKPQKDEVLRY
PDRSLSPEDAESLSVLSVPSPDTANQEPTPKSPCGLTEQYLHKDRWPEVSPEDTQSLSLS
EESPSKETSLDVSSKQLSPESLGTLQFGELNLGKEEMGHLMQAEDTSHHTAPMSVPEPHA
ATASPPTDGTTRYSAQTDITDDSLDRKSPASSFSHSTPSGNGKYLPGAITSPDEHILTPD
SSFSKSPESLPGPALEDIAIKWEDKVPGLKDRTSEQKKEPEPKDEVLQQKDKTLEHKEVV
EPKDTAIYQKDEALHVKNEAVKQQDKALEQKGRDLEQKDTALEQKDKALEPKDKDLEEKD
KALEQKDKIPEEKDKALEQKDTALEQKDKALEPKDKDLEQKDRVLEQKEKIPEEKDKALD
QKVRSVEHKAPEDTVAEMKDRDLEQTDKAPEQKHQAQEQKDKVSEKKDQALEQKYWALGQ
KDEALEQNIQALEENHQTQEQESLVQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKA
LGLEESLVQEGRAREQEEKYWRGQDVVQEWQETSPTREEPAGEQKELAPAWEDTSPEQDN
RYWRGREDVALEQDTYWRELSCERKVWFPHELDGQGARPHYTEERESTFLDEGPDDEQEV
PLREHATRSPWASDFKDFQESSPQKGLEVERWLAESPVGLPPEEEDKLTRSPFEIISPPA
SPPEMVGQRVPSAPGQESPIPDPKLMPHMKNEPTTPSWLADIPPWVPKDRPLPPAPLSPA
PGPPTPAPESHTPAPFSWGTAEYDSVVAAVQEGAAELEGGPYSPLGKDYRKAEGEREEEG
RAEAPDKSSHSSKVPEASKSHATTEPEQTEPEQREPTPYPDERSFQYADIYEQMMLTGLG
PACPTREPPLGAAGDWPPCLSTKEAAAGRNTSAEKELSSPISPKSLQSDTPTFSYAALAG
PTVPPRPEPGPSMEPSLTPPAVPPRAPILSKGPSPPLNGNILSCSPDRRSPSPKESGRSH
WDDSTSDSELEKGAREQPEKEAQSPSPPHPIPMGSPTLWPETEAHVSPPLDSHLGPARPS
LDFPASAFGFSSLQPAPPQLPSPAEPRSAPCGSLAFSGDRALALAPGPPTRTRHDEYLEV
TKAPSLDSSLPQLPSPSSPGAPLLSNLPRPASPALSEGSSSEATTPVISSVAERFSPSLE
AAEQESGELDPGMEPAAHSLWDLTPLSPAPPASLDLALAPAPSLPGDMGDGILPCHLECS
EAATEKPSPFQVPSEDCAANGPTETSPNPPGPAPAKAENEEAAACPAWERGAWPEGAERS
SRPDTLLSPEQPVCPAGGSGGPPSSASPEVEAGPQGCATEPRPHRGELSPSFLNPPLPPS
IDDRDLSTEEVRLVGRGGRRRVGGPGTTGGPCPVTDETPPTSASDSGSSQSDSDVPPETE
ECPSITAEAALDSDEDGDFLPVDKAGGVSGTHHPRPGHDPPPLPQPDPRPSPPRPDVCMA
DPEGLSSESGRVERLREKEKVQGRVGRRAPGKAKPASPARRLDLRGKRSPTPGKGPADRA
SRAPPRPRSTTSQVTPAEEKDGHSPMSKGLVNGLKAGPMALSSKGSSGAPVYVDLAYIPN
HCSGKTADLDFFRRVRASYYVVSGNDPANGEPSRAVLDALLEGKAQWGENLQVTLIPTHD
TEVTREWYQQTHEQQQQLNVLVLASSSTVVMQDESFPACKIEF
Number of residues
2803
Molecular Weight
305482.26
Theoretical pI
4.57
GO Classification
Functions
structural molecule activity
Processes
microtubule cytoskeleton organization / mitophagy in response to mitochondrial depolarization / photoreceptor cell maintenance / positive regulation of defense response to virus by host / sensory perception of sound / xenophagy
Components
cytosol / microtubule / microtubule associated complex / neuronal postsynaptic density / photoreceptor outer segment
General Function
Structural molecule activity
Specific Function
Structural protein involved in the filamentous cross-bridging between microtubules and other skeletal elements.
Pfam Domain Function
Not Available
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0021972|Microtubule-associated protein 1A (MAP1A)
ATGGACGGCGTGGCTGAGTTCTCCGAGTATGTCTCTGAGACTGTGGACGTGCCATCCCCA
TTTGACCTACTAGAGCCCCCCACCTCAGGGGGCTTCCTCAAGCTCTCCAAGCCTTGTTGC
TACATCTTCCCAGGTGGTCGTGGGGACTCTGCCCTCTTTGCTGTCAATGGTTTCAACATC
CTGGTGGATGGTGGCTCTGATCGCAAGTCCTGTTTTTGGAAGCTGGTACGGCACTTGGAC
CGCATTGACTCGGTGCTACTCACACACATTGGGGCAGACAACCTGCCAGGCATCAATGGA
CTACTGCAGCGCAAAGTGGCAGAGCTAGAGGAGGAGCAGTCCCAGGGCTCTAGCAGTTAC
AGCGACTGGGTGAAGAACCTTATCTCTCCTGAGCTTGGAGTTGTCTTTTTCAACGTGCCT
GAGAAGCTGCGGCTTCCTGATGCCTCCCGGAAAGCCAAGCGTAGCATTGAGGAGGCCTGC
CTCACTCTGCAGCACTTAAACCGCCTGGGCATCCAGGCTGAGCCTCTATATCGTGTGGTC
AGCAATACCATTGAGCCACTGACCCTCTTCCACAAAATGGGTGTGGGCCGGCTGGACATG
TATGTCCTCAACCCTGTCAAGGACAGCAAGGAGATGCAGTTCCTCATGCAAAAGTGGGCA
GGCAATAGTAAAGCCAAGACAGGCATCGTGCTGCCCAATGGGAAGGAGGCTGAGATCTCC
GTGCCCTACCTTACCTCTATCACTGCTCTGGTGGTCTGGCTACCAGCCAATCCCACTGAG
AAGATTGTGCGTGTGCTTTTTCCAGGAAATGCTCCCCAAAACAAGATCTTGGAGGGCCTA
GAAAAGCTTCGGCATCTGGACTTCCTGCGTTACCCTGTGGCCACGCAGAAGGACCTGGCT
TCTGGGGCTGTGCCTACCAACCTCAAGCCCAGCAAAATCAAACAGCGGGCTGATAGCAAG
GAGAGCCTCAAAGCCACTACCAAGACGGCCGTGAGCAAGTTGGCCAAACGGGAGGAGGTG
GTAGAAGAGGGAGCCAAGGAGGCACGTTCAGAGCTGGCCAAGGAGTTAGCCAAGACAGAG
AAGAAGGCAAAAGAGTCATCTGAGAAGCCCCCAGAGAAGCCTGCCAAGCCTGAGAGGGTG
AAGACAGAGTCAAGTGAGGCACTGAAGGCAGAGAAGCGAAAGCTGATCAAAGACAAGGTA
GGGAAAAAGCACCTTAAAGAAAAGATATCAAAGCTGGAAGAAAAAAAAGACAAGGAGAAA
AAAGAGATCAAAAAGGAGAGGAAAGAGCTCAAGAAGGATGAAGGAAGGAAGGAGGAGAAG
AAGGATGCCAAGAAGGAGGAGAAGAGGAAAGATACCAAACCTGAGCTCAAGAAGATTTCC
AAGCCAGACCTAAAGCCCTTTACTCCTGAGGTACGTAAGACCCTCTATAAAGCCAAGGTC
CCTGGAAGAGTCAAAATAGACAGGAGCCGTGCTATCCGTGGGGAGAAGGAGCTGTCTTCT
GAGCCCCAGACACCCCCAGCCCAGAAGGGAACTGTACCACTCCCAACCATCAGTGGGCAC
AGGGAGCTGGTCCTATCCTCACCAGAGGACCTCACACAGGACTTTGAGGAGATGAAGCGT
GAGGAGAGGGCTTTGCTGGCTGAACAAAGGGACACAGGACTAGGAGATAAGCCATTCCCT
CTAGACACTGCAGAGGAGGGACCCCCAAGTACAGCTATCCAGGGAACACCACCCTCTGTT
CCAGGGCTGGGACAAGAAGAACATGTGATGAAGGAGAAAGAGCTTGTCCCAGAGGTCCCT
GAGGAACAAGGCAGCAAGGACAGAGGCCTAGACTCTGGGGCTGAAACAGAGGAAGAGAAA
GATACCTGGGAGGAAAAGAAGCAGAGGGAAGCAGAGAGGCTCCCAGACAGAACAGAAGCC
AGAGAGGAAAGTGAACCTGAAGTAAAGGAGGATGTGATAGAAAAGGCTGAGTTAGAAGAA
ATGGAGGAGGTACACCCTTCAGATGAGGAGGAAGAGGACGCGACAAAAGCTGAGGGTTTT
TACCAAAAACATATGCAGGAACCCTTGAAGGTAACTCCAAGGAGCCGGGAGGCTTTTGGG
GGTCGGGAATTGGGACTCCAGGGCAAGGCCCCTGAGAAGGAGACCTCGTTATTCCTAAGC
AGCCTGACCACACCTGCAGGAGCCACTGAGCATGTCTCTTACATCCAGGATGAGACAATC
CCTGGCTACTCAGAGACTGAGCAGACCATCTCAGATGAGGAGATCCATGATGAGCCGGAG
GAGCGCCCAGCTCCACCCAGATTTCATACAAGTACATATGACCTGCCCGGGCCTGAAGGT
GCTGGCCCATTCGAAGCCAGCCAACCTGCCGATAGTGCTGTTCCTGCTACCTCTGGCAAA
GTCTATGGAACGCCAGAGACTGAACTCACCTACCCCACTAACATAGTGGCTGCCCCTTTG
GCTGAAGAGGAACATGTGTCCTCGGCCACTTCAATCACTGAGTGTGACAAACTTTCTTCC
TTTGCCACATCAGTGGCTGAGGACCAATCTGTGGCCTCACTTACAGCTCCCCAGACAGAG
GAGACAGGCAAGAGCTCCCTGCTGCTTGACACAGTCACAAGCATCCCTTCCTCCCGTACT
GAAGCTACGCAGGGCTTGGACTATGTGCCATCAGCTGGTACCATCTCACCCACCTCCTCA
CTGGAAGAAGACAAGGGCTTCAAATCACCACCCTGTGAGGACTTCTCTGTGACTGGGGAG
TCAGAGAAGAGAGGAGAGATCATAGGGAAAGGCTTGTCTGGAGAGAGAGCTGTGGAAGAG
GAAGAGGAGGAGACAGCAAACGTAGAGATGTCTGAGAAACTTTGCAGTCAATATGGAACT
CCAGTGTTTAGTGCCCCTGGGCATGCCCTACATCCAGGAGAACCAGCCCTTGGAGAAGCA
GAGGAGCGGTGCCTTAGCCCAGATGACAGCACAGTGAAGATGGCTTCTCCTCCACCATCT
GGCCCACCCAGTGCCACCCACACACCCTTTCATCAGTCCCCAGTGGAAGAAAAGTCTGAG
CCCCAAGACTTTCAGGAGGCAGACTCCTGGGGAGACACTAAGCGCACACCAGGTGTGGGC
AAAGAAGATGCTGCTGAGGAGACAGTCAAGCCAGGGCCTGAAGAGGGCACACTAGAGAAG
GAAGAGAAAGTTCCTCCTCCCAGGAGCCCCCAGGCCCAGGAAGCACCTGTCAACATTGAT
GAGGGGCTTACAGGCTGTACCATTCAACTGTTGCCAGCACAGGATAAAGCAATAGTCTTT
GAGATTATGGAGGCAGGAGAGCCCACAGGCCCAATTCTGGGAGCAGAAGCCCTTCCCGGA
GGTTTGAGGACTTTACCCCAAGAACCTGGCAAACCTCAGAAAGATGAGGTGCTCAGATAT
CCTGACCGAAGCCTCTCTCCTGAAGATGCAGAATCCCTCTCTGTCCTCAGCGTGCCCTCC
CCAGACACTGCCAACCAAGAGCCTACCCCCAAGTCTCCCTGTGGCCTGACAGAACAGTAC
CTACACAAAGACCGTTGGCCAGAGGTATCTCCAGAAGACACCCAGTCACTTTCTCTGTCA
GAAGAGAGTCCCAGCAAGGAGACCTCCCTGGATGTCTCTTCTAAGCAGCTCTCTCCAGAA
AGCCTTGGCACCCTCCAGTTTGGGGAACTAAACCTTGGGAAGGAAGAAATGGGGCATCTG
ATGCAGGCCGAGGATACCTCTCACCACACAGCTCCCATGTCTGTTCCAGAGCCCCATGCA
GCCACAGCGTCACCTCCCACAGATGGGACAACTCGATACTCTGCACAGACAGACATCACA
GATGACAGCCTTGACAGGAAGTCACCTGCCAGCTCATTCTCTCACTCTACACCTTCAGGA
AATGGGAAGTACTTACCTGGGGCGATCACAAGCCCTGATGAACACATTCTGACACCTGAT
AGCTCCTTCTCCAAGAGTCCTGAGTCTTTGCCAGGCCCTGCCTTGGAGGACATTGCCATA
AAGTGGGAAGATAAAGTTCCAGGGTTGAAAGACAGAACCTCAGAACAGAAGAAGGAACCT
GAGCCAAAGGATGAAGTTTTACAGCAGAAAGACAAAACTCTGGAGCACAAGGAGGTGGTA
GAGCCGAAGGATACAGCCATCTATCAGAAAGATGAGGCTCTGCATGTAAAGAATGAGGCT
GTGAAACAGCAGGATAAGGCTTTAGAACAAAAGGGCAGAGACTTAGAGCAAAAAGACACA
GCCCTAGAACAGAAGGACAAGGCCCTGGAACCAAAAGACAAAGACTTAGAAGAAAAAGAC
AAGGCCCTGGAACAGAAGGATAAGATTCCAGAAGAGAAAGACAAAGCCTTAGAACAAAAG
GATACAGCCCTGGAACAGAAGGACAAGGCCCTGGAACCAAAAGATAAAGACTTGGAACAA
AAGGACAGGGTCCTAGAACAGAAGGAGAAGATCCCAGAAGAGAAAGACAAAGCCTTAGAT
CAAAAAGTCAGAAGTGTTGAACATAAGGCTCCGGAGGACACGGTCGCTGAAATGAAGGAC
AGAGACCTAGAACAGACAGACAAAGCCCCTGAACAGAAACACCAGGCCCAGGAACAAAAG
GATAAAGTCTCAGAAAAGAAGGATCAGGCCTTAGAACAAAAATACTGGGCTTTGGGACAG
AAGGATGAAGCCCTGGAACAAAACATTCAGGCTCTGGAAGAGAACCACCAAACTCAGGAG
CAGGAGAGCCTAGTGCAGGAGGATAAAACCAGGAAACCAAAGATGCTAGAGGAAAAATCC
CCAGAAAAGGTCAAGGCCATGGAAGAGAAGTTAGAAGCTCTTCTGGAGAAGACCAAAGCT
CTGGGCCTGGAAGAGAGCCTAGTGCAGGAGGGCAGGGCCAGAGAGCAGGAAGAAAAGTAC
TGGAGGGGGCAGGATGTGGTCCAGGAGTGGCAAGAAACATCTCCTACCAGAGAGGAGCCG
GCTGGAGAACAGAAAGAGCTTGCCCCGGCATGGGAGGACACATCTCCTGAGCAGGACAAT
AGGTATTGGAGGGGCAGAGAGGATGTGGCCTTGGAACAGGACACATACTGGAGGGAGCTA
AGCTGTGAGCGGAAGGTCTGGTTCCCTCACGAGCTGGATGGCCAGGGGGCCCGCCCACAC
TACACTGAGGAACGGGAAAGCACTTTCCTAGATGAGGGCCCAGATGATGAGCAAGAAGTA
CCCCTGCGGGAACACGCAACCCGGAGCCCCTGGGCCTCAGACTTCAAGGATTTCCAGGAA
TCCTCACCACAGAAGGGGCTAGAGGTGGAGCGCTGGCTTGCTGAATCACCAGTTGGGTTG
CCACCAGAGGAAGAGGACAAACTGACCCGCTCTCCCTTTGAGATCATCTCCCCTCCAGCT
TCCCCACCTGAGATGGTTGGACAAAGGGTTCCTTCAGCCCCAGGACAAGAGAGTCCTATC
CCAGACCCTAAGCTCATGCCACACATGAAGAATGAACCCACTACTCCCTCATGGCTGGCT
GACATCCCACCCTGGGTGCCCAAGGACAGACCCCTCCCCCCTGCACCCCTCTCCCCAGCT
CCTGGTCCCCCCACACCTGCCCCGGAATCCCATACTCCTGCACCCTTCTCTTGGGGCACA
GCCGAGTATGACAGTGTGGTGGCTGCAGTGCAGGAGGGGGCAGCTGAGTTGGAAGGTGGG
CCATACTCCCCCCTGGGGAAGGACTACCGCAAGGCTGAAGGGGAAAGGGAAGAAGAAGGT
AGGGCTGAGGCTCCTGACAAAAGCTCACACAGCTCAAAGGTACCAGAGGCCAGCAAAAGC
CATGCCACCACGGAGCCTGAGCAGACTGAGCCGGAGCAGAGAGAGCCCACACCCTATCCT
GATGAGAGAAGCTTTCAGTATGCAGACATCTATGAGCAGATGATGCTTACTGGGCTTGGC
CCTGCATGCCCCACTAGAGAGCCTCCACTTGGAGCAGCTGGGGATTGGCCCCCATGCCTC
TCAACCAAGGAGGCAGCTGCCGGCCGAAACACATCTGCAGAGAAGGAGCTTTCATCTCCT
ATCTCACCCAAGAGCCTCCAGTCTGACACTCCAACCTTCAGCTATGCAGCCCTGGCAGGA
CCCACTGTACCCCCAAGGCCAGAGCCAGGGCCAAGTATGGAGCCCAGCCTCACCCCACCT
GCAGTTCCCCCCCGTGCTCCTATCCTGAGCAAAGGCCCAAGCCCCCCTCTTAATGGTAAC
ATCCTGAGCTGCAGCCCAGATAGGAGGTCCCCATCCCCCAAGGAATCAGGCCGGAGTCAC
TGGGATGACAGCACTAGTGACTCAGAACTGGAGAAGGGGGCTCGGGAACAGCCAGAAAAA
GAGGCCCAATCCCCAAGTCCTCCTCACCCCATTCCTATGGGGTCCCCCACATTATGGCCA
GAAACTGAGGCACATGTTAGCCCTCCCTTGGACTCACACCTGGGGCCTGCCCGACCCAGT
CTGGACTTCCCTGCTTCAGCCTTTGGCTTCTCCTCATTGCAGCCAGCTCCCCCACAGCTG
CCCTCTCCAGCTGAACCCCGCTCGGCACCCTGTGGCTCCCTTGCCTTCTCTGGGGATCGA
GCTCTGGCTCTGGCTCCAGGACCCCCCACCAGAACCCGGCATGATGAATACCTGGAAGTG
ACCAAGGCCCCCAGCCTGGATTCCTCACTGCCCCAGCTCCCATCACCCAGTTCTCCTGGG
GCCCCTCTCCTCTCCAATCTGCCACGACCTGCCTCACCAGCCCTGTCTGAGGGCTCCTCC
TCTGAGGCTACCACGCCTGTGATTTCAAGTGTGGCGGAGCGCTTCTCTCCAAGCCTTGAG
GCTGCAGAACAGGAGTCTGGAGAGCTGGACCCAGGAATGGAACCAGCTGCCCACAGCCTC
TGGGACCTCACTCCTCTGAGCCCAGCACCCCCAGCTTCACTGGACTTGGCCCTAGCTCCA
GCTCCAAGCCTGCCTGGAGACATGGGTGATGGCATCCTGCCGTGCCACCTGGAGTGCTCA
GAGGCAGCCACGGAGAAGCCAAGCCCCTTCCAGGTTCCCTCTGAGGATTGTGCAGCCAAT
GGCCCAACTGAAACCAGCCCTAACCCCCCAGGCCCTGCCCCAGCCAAGGCTGAAAATGAA
GAGGCTGCGGCTTGCCCTGCCTGGGAACGTGGGGCCTGGCCTGAAGGAGCTGAGAGGAGC
TCCCGGCCTGACACATTGCTCTCCCCTGAGCAGCCAGTGTGTCCTGCAGGGGGCTCCGGG
GGCCCACCCAGCAGTGCCTCTCCTGAGGTCGAAGCTGGGCCCCAGGGATGTGCCACTGAG
CCTCGGCCCCATCGTGGGGAGCTCTCCCCATCCTTCCTGAACCCACCTCTGCCCCCATCC
ATAGATGATAGGGACCTCTCAACTGAGGAAGTTCGGCTAGTAGGAAGAGGGGGGCGGCGC
CGGGTAGGGGGGCCAGGGACCACTGGGGGCCCATGCCCTGTGACTGATGAGACACCCCCT
ACATCAGCCAGTGACTCAGGCTCCTCACAGTCAGATTCTGATGTCCCGCCAGAAACTGAG
GAGTGTCCGTCCATCACAGCTGAGGCAGCCCTCGACTCAGATGAAGATGGAGACTTCCTA
CCTGTGGACAAAGCTGGGGGTGTCAGTGGTACTCACCACCCCAGGCCTGGCCATGACCCA
CCTCCTCTCCCACAGCCAGACCCCCGCCCATCCCCTCCCCGCCCTGATGTGTGCATGGCT
GACCCCGAGGGGCTCAGCTCAGAGTCTGGGAGAGTAGAGAGGCTACGGGAGAAGGAAAAG
GTTCAGGGGCGAGTAGGGCGCAGGGCCCCAGGCAAGGCCAAGCCAGCGTCCCCTGCACGG
CGTCTGGATCTTCGGGGAAAACGCTCACCCACCCCTGGTAAAGGGCCTGCAGATCGAGCA
TCCCGGGCCCCACCTCGACCACGCAGCACCACAAGCCAGGTCACCCCAGCAGAGGAAAAG
GATGGACACAGCCCCATGTCCAAAGGCCTAGTCAATGGACTCAAGGCAGGACCAATGGCC
TTGAGTTCCAAGGGCAGCTCTGGTGCCCCTGTATATGTGGATCTCGCCTACATCCCGAAT
CATTGCAGTGGCAAGACTGCTGACCTTGACTTCTTCCGTCGAGTGCGTGCATCCTACTAT
GTGGTCAGTGGGAATGACCCTGCCAATGGCGAGCCAAGCCGGGCTGTGCTGGATGCCCTG
CTGGAGGGCAAGGCCCAGTGGGGGGAGAATCTTCAGGTGACTCTGATCCCTACTCATGAC
ACGGAGGTGACTCGTGAGTGGTACCAACAAACTCATGAGCAGCAGCAACAACTGAATGTC
CTGGTCCTGGCTAGCAGCAGCACCGTGGTGATGCAGGATGAGTCCTTCCCTGCCTGCAAG
ATTGAGTTCTGA
Chromosome Location
15
Locus
15q13-qter
External Identifiers
ResourceLink
UniProtKB IDP78559
UniProtKB Entry NameMAP1A_HUMAN
GenBank Protein ID1790878
GenBank Gene IDU38291
GenAtlas IDMAP1A
HGNC IDHGNC:6835
General References
  1. Fink JK, Jones SM, Esposito C, Wilkowski J: Human microtubule-associated protein 1a (MAP1A) gene: genomic organization, cDNA sequence, and developmental- and tissue-specific expression. Genomics. 1996 Aug 1;35(3):577-85. [PubMed:8812494]
  2. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171]
  3. Fukuyama R, Rapoport SI: Brain-specific expression of human microtubule-associated protein 1A (MAP1A) gene and its assignment to human chromosome 15. J Neurosci Res. 1995 Apr 15;40(6):820-5. [PubMed:7629894]
  4. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186]
  5. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  7. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332]
  8. Zou B, Yan H, Kawasaki F, Ordway RW: MAP1 structural organization in Drosophila: in vivo analysis of FUTSCH reveals heavy- and light-chain subunits generated by proteolytic processing at a conserved cleavage site. Biochem J. 2008 Aug 15;414(1):63-71. doi: 10.1042/BJ20071449. [PubMed:18419581]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  10. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  11. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  12. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  13. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  14. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01196Estramustineapproved, investigationalyesantagonistDetails