30S ribosomal protein S3
Details
- Name
- 30S ribosomal protein S3
- Synonyms
- rps3
- Gene Name
- rpsC
- Organism
- Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
- Amino acid sequence
>lcl|BSEQ0012947|30S ribosomal protein S3 MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERA ADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRV AEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRA NIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE
- Number of residues
- 239
- Molecular Weight
- 26700.81
- Theoretical pI
- 11.34
- GO Classification
- FunctionsmRNA binding / rRNA binding / structural constituent of ribosomeProcessestranslationComponentssmall ribosomal subunit
- General Function
- Structural constituent of ribosome
- Specific Function
- Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation.
- Pfam Domain Function
- KH_2 (PF07650)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
>lcl|BSEQ0012948|30S ribosomal protein S3 (rpsC) ATGGGAAATAAGATCCACCCCATCGGTTTCCGGCTCGGCATCACCCGGGACTGGGAGTCC CGCTGGTACGCCGGCAAGAAGCAGTACCGCCACCTGCTCCTCGAAGACCAGAGGATCCGG GGCCTTTTGGAGAAGGAGCTCTACTCGGCGGGCCTCGCCCGGGTGGACATTGAGCGGGCC GCCGACAACGTGGCCGTGACCGTCCACGTGGCCAAGCCCGGGGTGGTCATCGGCCGGGGT GGCGAGCGGATCCGGGTGCTCCGGGAGGAGCTGGCCAAGCTCACCGGCAAGAACGTGGCC CTGAACGTCCAGGAGGTGCAGAACCCCAACCTCTCCGCCCCCCTCGTGGCCCAGCGGGTG GCGGAGCAGATTGAGCGCCGCTTCGCCGTGCGCCGGGCCATCAAGCAGGCGGTTCAGCGG GTTATGGAGTCCGGGGCCAAGGGGGCCAAGGTGATCGTCTCCGGCCGCATCGGCGGGGCC GAGCAGGCGCGCACCGAGTGGGCCGCCCAGGGGCGGGTGCCCCTCCACACCCTGCGTGCT AACATAGACTACGGCTTTGCCTTGGCCCGGACCACCTACGGCGTCCTCGGGGTCAAGGCC TACATCTTCCTGGGCGAGGTGATCGGCGGCCAGAAGCCCAAGGCCCGGCCCGAGCTGCCG AAGGCCGAGGAGAGGCCCCGCCGCCGTCGCCCTGCCGTGCGCGTGAAGAAGGAGGAGTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P80372 UniProtKB Entry Name RS3_THET8 GenBank Protein ID 55771383 GenBank Gene ID AP008226 - General References
- Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [Article]
- Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
- Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [Article]
- Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [Article]
- Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [Article]
- Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [Article]
- Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [Article]
- Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [Article]
- Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [Article]
- Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
- Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [Article]
- Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [Article]