Cytochrome c-553
Details
- Name
- Cytochrome c-553
- Synonyms
- Cytochrome c553
- Gene Name
- Not Available
- Organism
- Sporosarcina pasteurii
- Amino acid sequence
>lcl|BSEQ0016925|Cytochrome c-553 GGGNDTSNETDTGTSGGETAAVDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEI LDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK
- Number of residues
- 92
- Molecular Weight
- 8990.665
- Theoretical pI
- 3.88
- GO Classification
- Functionselectron carrier activity / heme binding / iron ion bindingProcessesoxidation-reduction processComponentsintegral component of membrane / plasma membrane
- General Function
- Iron ion binding
- Specific Function
- Natural electron acceptor for a formate dehydrogenase.
- Pfam Domain Function
- Cytochrome_CBB3 (PF13442)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P82599 UniProtKB Entry Name CY553_SPOPA - General References
- Vandenberghe IH, Guisez Y, Ciurli S, Benini S, Van Beeumen JJ: Cytochrome c-553 from the alkalophilic bacterium Bacillus pasteurii has the primary structure characteristics of a lipoprotein. Biochem Biophys Res Commun. 1999 Oct 22;264(2):380-7. [Article]