Cytochrome c-553

Details

Name
Cytochrome c-553
Synonyms
  • Cytochrome c553
Gene Name
Not Available
Organism
Sporosarcina pasteurii
Amino acid sequence
>lcl|BSEQ0016925|Cytochrome c-553
GGGNDTSNETDTGTSGGETAAVDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEI
LDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK
Number of residues
92
Molecular Weight
8990.665
Theoretical pI
3.88
GO Classification
Functions
electron carrier activity / heme binding / iron ion binding
Processes
oxidation-reduction process
Components
integral component of membrane / plasma membrane
General Function
Iron ion binding
Specific Function
Natural electron acceptor for a formate dehydrogenase.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP82599
UniProtKB Entry NameCY553_SPOPA
General References
  1. Vandenberghe IH, Guisez Y, Ciurli S, Benini S, Van Beeumen JJ: Cytochrome c-553 from the alkalophilic bacterium Bacillus pasteurii has the primary structure characteristics of a lipoprotein. Biochem Biophys Res Commun. 1999 Oct 22;264(2):380-7. [PubMed:10529373]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails