Cytochrome b6-f complex subunit 6
Details
- Name
- Cytochrome b6-f complex subunit 6
- Synonyms
- Cytochrome b6-f complex subunit PetL
- Cytochrome b6-f complex subunit VI
- Gene Name
- petL
- Organism
- Mastigocladus laminosus
- Amino acid sequence
>lcl|BSEQ0012725|Cytochrome b6-f complex subunit 6 MILGAVFYIVFIALFFGIAVGIIFAIKSIKLI
- Number of residues
- 32
- Molecular Weight
- 3502.415
- Theoretical pI
- 10.25
- GO Classification
- Functionselectron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activityProcessesoxidation-reduction process / photosynthesisComponentscytochrome b6f complex / integral component of membrane / thylakoid membrane
- General Function
- Electron transporter, transferring electrons within cytochrome b6/f complex of photosystem ii activity
- Specific Function
- Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions (PubMed:14526088). PetL is important for photoautotrophic growth as well as for electron transfer efficiency and stability of the cytochrome b6-f complex.
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- 6-26
- Cellular Location
- Cellular thylakoid membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P83795 UniProtKB Entry Name PETL_MASLA - General References
- Kurisu G, Zhang H, Smith JL, Cramer WA: Structure of the cytochrome b6f complex of oxygenic photosynthesis: tuning the cavity. Science. 2003 Nov 7;302(5647):1009-14. Epub 2003 Oct 2. [Article]