Peptide deformylase

Details

Name
Peptide deformylase
Synonyms
  • 3.5.1.88
  • PDF
  • Polypeptide deformylase
Gene Name
def
Organism
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Amino acid sequence
>lcl|BSEQ0019381|Peptide deformylase
MYRIRVFGDPVLRKRAKPVTKFDENLKKTIERMIETMYHYDGVGLAAPQVGISQRFFVMD
VGNGPVAVINPEILEIDPETEVAEEGCLSFPEIFVEIERSKRIKVKYQNTRGEYVEEELE
GYAARVFQHEFDHLNGVLIIDRISPAKRLLLRKKLMDIARTVKR
Number of residues
164
Molecular Weight
19023.965
Theoretical pI
8.43
GO Classification
Functions
iron ion binding / peptide deformylase activity
Processes
translation
General Function
Peptide deformylase activity
Specific Function
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0019382|Peptide deformylase (def)
ATGTACAGAATAAGAGTCTTTGGAGATCCCGTCTTGAGAAAGAGGGCAAAACCCGTTACA
AAGTTCGACGAGAACCTGAAAAAGACCATAGAAAGAATGATAGAGACGATGTATCACTAC
GACGGTGTGGGACTCGCGGCACCGCAGGTTGGAATATCTCAGAGGTTCTTCGTCATGGAC
GTTGGAAATGGTCCGGTTGCCGTGATAAATCCGGAGATTCTTGAAATCGATCCAGAAACT
GAAGTAGCAGAAGAGGGGTGCCTCAGCTTTCCCGAGATCTTCGTCGAGATAGAAAGGAGC
AAAAGAATAAAGGTCAAATACCAGAACACAAGGGGAGAATACGTGGAAGAAGAACTGGAA
GGTTACGCTGCAAGGGTTTTTCAGCACGAGTTCGATCATCTGAACGGAGTTTTGATCATC
GATCGAATCAGTCCAGCAAAGCGCCTTTTGCTCAGAAAGAAACTCATGGACATAGCAAGA
ACCGTTAAGAGATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP96113
UniProtKB Entry NameDEF_THEMA
GenBank Gene IDY10306
General References
  1. Mazel D, Coic E, Blanchard S, Saurin W, Marliere P: A survey of polypeptide deformylase function throughout the eubacterial lineage. J Mol Biol. 1997 Mar 14;266(5):939-49. [PubMed:9086272]
  2. Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC, Ketchum KA, McDonald L, Utterback TR, Malek JA, Linher KD, Garrett MM, Stewart AM, Cotton MD, Pratt MS, Phillips CA, Richardson D, Heidelberg J, Sutton GG, Fleischmann RD, Eisen JA, White O, Salzberg SL, Smith HO, Venter JC, Fraser CM: Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima. Nature. 1999 May 27;399(6734):323-9. [PubMed:10360571]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03661Cysteinesulfonic AcidexperimentalunknownDetails