Low-density lipoprotein receptor-related protein 2

Details

Name
Low-density lipoprotein receptor-related protein 2
Synonyms
  • Glycoprotein 330
  • gp330
  • LRP-2
  • Megalin
Gene Name
LRP2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010661|Low-density lipoprotein receptor-related protein 2
MDRGPAAVACTLLLALVACLAPASGQECDSAHFRCGSGHCIPADWRCDGTKDCSDDADEI
GCAVVTCQQGYFKCQSEGQCIPNSWVCDQDQDCDDGSDERQDCSQSTCSSHQITCSNGQC
IPSEYRCDHVRDCPDGADENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEINCT
EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWV
CDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENN
TSTGKYCSMTLCSALNCQYQCHETPYGGACFCPPGYIINHNDSRTCVEFDDCQIWGICDQ
KCESRPGRHLCHCEEGYILERGQYCKANDSFGEASIIFSNGRDLLIGDIHGRSFRILVES
QNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDINGLNIQEVLNVSVETPENLAVDWVNNK
IYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGVTLDMISKRVYWVDSRFDYIETVTYDGIQRKTVVHGGSL
IPHPFGVSLFEGQVFFTDWTKMAVLKANKFTETNPQVYYQASLRPYGVTVYHSLRQPYAT
NPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLDTDERHCIAVQNFLIFSSQVAIR
GIPFTLSTQEDVMVPVSGNPSFFVGIDFDAQDSTIFFSDMSKHMIFKQKIDGTGREILAA
NRVENVESLAFDWISKNLYWTDSHYKSISVMRLADKTRRTVVQYLNNPRSVVVHPFAGYL
FFTDWFRPAKIMRAWSDGSHLLPVINTTLGWPNGLAIDWAASRLYWVDAYFDKIEHSTFD
GLDRRRLGHIEQMTHPFGLAIFGEHLFFTDWRLGAIIRVRKADGGEMTVIRSGIAYILHL
KSYDVNIQTGSNACNQPTHPNGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPTNE
PPTEQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECI
PAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDE
KNCNSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKC
IGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGS
DEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCL
GHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFL
LANDSKTCEDIDECDILGSCSQHCYNMRGSFRCSCDTGYMLESDGRTCKVTASESLLLLV
ASQNKIIADSVTSQVHNIYSLVENGSYIVAVDFDSISGRIFWSDATQGKTWSAFQNGTDR
RVVFDSSIILTETIAIDWVGRNLYWTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALD
PRMNEHLLFWSDWGHHPRIERASMDGSMRTVIVQDKIFWPCGLTIDYPNRLLYFMDSYLD
YMDFCDYNGHHRRQVIASDLIIRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVM
YNIQWPLGIVAVHPSKQPNSVNPCAFSRCSHLCLLSSQGPHFYSCVCPSGWSLSPDLLNC
LRDDQPFLITVRQHIIFGISLNPEVKSNDAMVPIAGIQNGLDVEFDDAEQYIYWVENPGE
IHRVKTDGTNRTVFASISMVGPSMNLALDWISRNLYSTNPRTQSIEVLTLHGDIRYRKTL
IANDGTALGVGFPIGITVDPARGKLYWSDQGTDSGVPAKIASANMDGTSVKTLFTGNLEH
LECVTLDIEEQKLYWAVTGRGVIERGNVDGTDRMILVHQLSHPWGIAVHDSFLYYTDEQY
EVIERVDKATGANKIVLRDNVPNLRGLQVYHRRNAAESSNGCSNNMNACQQICLPVPGGL
FSCACATGFKLNPDNRSCSPYNSFIVVSMLSAIRGFSLELSDHSETMVPVAGQGRNALHV
DVDVSSGFIYWCDFSSSVASDNAIRRIKPDGSSLMNIVTHGIGENGVRGIAVDWVAGNLY
FTNAFVSETLIEVLRINTTYRRVLLKVTVDMPRHIVVDPKNRYLFWADYGQRPKIERSFL
DCTNRTVLVSEGIVTPRGLAVDRSDGYVYWVDDSLDIIARIRINGENSEVIRYGSRYPTP
YGITVFENSIIWVDRNLKKIFQASKEPENTEPPTVIRDNINWLRDVTIFDKQVQPRSPAE
VNNNPCLENNGGCSHLCFALPGLHTPKCDCAFGTLQSDGKNCAISTENFLIFALSNSLRS
LHLDPENHSPPFQTINVERTVMSLDYDSVSDRIYFTQNLASGVGQISYATLSSGIHTPTV
IASGIGTADGIAFDWITRRIYYSDYLNQMINSMAEDGSNRTVIARVPKPRAIVLDPCQGY
LYWADWDTHAKIERATLGGNFRVPIVNSSLVMPSGLTLDYEEDLLYWVDASLQRIERSTL
TGVDREVIVNAAVHAFGLTLYGQYIYWTDLYTQRIYRANKYDGSGQIAMTTNLLSQPRGI
NTVVKNQKQQCNNPCEQFNGGCSHICAPGPNGAECQCPHEGNWYLANNRKHCIVDNGERC
GASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTCANGRCVQYSYRC
DYYNDCGDGSDEAGCLFRDCNATTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNCPDR
TCQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQCASGRCIPQH
WYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDKR
HQCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRTCSENEFTC
GYGLCIPKIFRCDRHNDCGDYSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDG
SDELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSIS
GCDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVCSQKCENVIGSYICKCAP
GYLREPDGKTCRQNSNIEPYLIFSNRYYLRNLTIDGYFYSLILEGLDNVVALDFDRVEKR
LYWIDTQRQVIERMFLNKTNKETIINHRLPAAESLAVDWVSRKLYWLDARLDGLFVSDLN
GGHRRMLAQHCVDANNTFCFDNPRGLALHPQYGYLYWADWGHRAYIGRVGMDGTNKSVII
STKLEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGHHRHTVYDGALPHPFAITIFEDTI
YWTDWNTRTVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLC
LIKPGGKGFTCECPDDFRTLQLSGSTYCMPMCSSTQFLCANNEKCIPIWWKCDGQKDCSD
GSDELALCPQRFCRLGQFQCSDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQ
CANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDC
GDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCH
PVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDH
YNDCGDNSDERDCEMRTCHPEYFQCTSGHCVHSELKCDGSADCLDASDEADCPTRFPDGA
YCQATMFECKNHVCIPPYWKCDGDDDCGDGSDEELHLCLDVPCNSPNRFRCDNNRCIYSH
EVCNGVDDCGDGTDETEEHCRKPTPKPCTEYEYKCGNGHCIPHDNVCDDADDCGDWSDEL
GCNKGKERTCAENICEQNCTQLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCPQH
CRNTKGSYECVCADGFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQD
EEYIQAVDYDWDPKDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKY
VMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGLMF
WTDWGKEPKIESAWMNGEDRNILVFEDLGWPTGLSIDYLNNDRIYWSDFKEDVIETIKYD
GTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRI
FHQLRYNKSVPNLCKQICSHLCLLRPGGYSCACPQGSSFIEGSTTECDAAIELPINLPPP
CRCMHGGNCYFDETDLPKCKCPSGYTGKYCEMAFSKGISPGTTAVAVLLTILLIVVIGAL
AIAGFFHYRRTGSLLPALPKLPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETAI
DRSMAMSEDFVMEMGKQPIIFENPMYSARDSAVKVVQPIQVTVSENVDNKNYGSPINPSE
IVPETNPTSPAADGTQVTKWNLFKRKSKQTTNFENPIYAQMENEQKESVAATPPPSPSLP
AKPKPPSRRDPTPTYSATEDTFKDTANLVKEDSEV
Number of residues
4655
Molecular Weight
521952.77
Theoretical pI
4.68
GO Classification
Functions
calcium ion binding
Processes
cell proliferation / endocytosis / forebrain development / lipid metabolic process / phototransduction, visible light / protein glycosylation / receptor-mediated endocytosis / retinoid metabolic process / small molecule metabolic process / steroid metabolic process / vitamin D metabolic process
Components
apical plasma membrane / brush border membrane / coated pit / endocytic vesicle / endoplasmic reticulum / endosome / extracellular exosome / Golgi apparatus / integral component of membrane / lysosomal membrane / lysosome / plasma membrane / receptor complex
General Function
Calcium ion binding
Specific Function
Acts together with cubilin to mediate HDL endocytosis (By similarity). May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release.
Pfam Domain Function
Transmembrane Regions
4424-4446
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010662|Low-density lipoprotein receptor-related protein 2 (LRP2)
ATGGATCGCGGGCCGGCAGCAGTGGCGTGCACGCTGCTCCTGGCTCTCGTCGCCTGCCTA
GCGCCGGCCAGTGGCCAAGAATGTGACAGTGCGCATTTTCGCTGTGGAAGTGGGCATTGC
ATCCCTGCAGACTGGAGGTGTGATGGGACCAAAGACTGTTCAGATGACGCGGATGAAATT
GGCTGCGCTGTTGTGACCTGCCAGCAGGGCTATTTCAAGTGCCAGAGTGAGGGACAATGC
ATCCCCAACTCCTGGGTGTGTGACCAAGATCAAGACTGTGATGATGGCTCAGATGAACGT
CAAGATTGCTCACAAAGTACATGCTCAAGTCATCAGATAACATGCTCCAATGGTCAGTGT
ATCCCAAGTGAATACAGGTGCGACCACGTCAGAGACTGCCCCGATGGAGCTGATGAGAAT
GACTGCCAGTACCCAACATGTGAGCAGCTTACTTGTGACAATGGGGCCTGCTATAACACC
AGTCAGAAGTGTGATTGGAAAGTTGATTGCAGGGACTCCTCAGATGAAATCAACTGCACT
GAGATATGCTTGCACAATGAGTTTTCATGTGGCAATGGAGAGTGTATCCCTCGTGCTTAT
GTCTGTGACCATGACAATGATTGCCAAGACGGCAGTGACGAACATGCTTGCAACTATCCG
ACCTGCGGTGGTTACCAGTTCACTTGCCCCAGTGGCCGATGCATTTATCAAAACTGGGTT
TGTGATGGAGAAGATGACTGTAAAGATAATGGAGATGAAGATGGATGTGAAAGCGGTCCT
CATGATGTTCATAAATGTTCCCCAAGAGAATGGTCTTGCCCAGAGTCGGGACGATGCATC
TCCATTTATAAAGTTTGTGATGGGATTTTAGATTGCCCAGGAAGAGAAGATGAAAACAAC
ACTAGTACCGGAAAATACTGTAGTATGACTCTGTGCTCTGCCTTGAACTGCCAGTACCAG
TGCCATGAGACGCCGTATGGAGGAGCGTGTTTTTGTCCCCCAGGTTATATCATCAACCAC
AATGACAGCCGTACCTGTGTTGAGTTTGATGATTGCCAGATATGGGGAATTTGTGACCAG
AAGTGTGAAAGCCGACCTGGCCGTCACCTGTGCCACTGTGAAGAAGGGTATATCTTGGAG
CGTGGACAGTATTGCAAAGCTAATGATTCCTTTGGCGAGGCCTCCATTATCTTCTCCAAT
GGTCGGGATTTGTTAATTGGTGATATTCATGGAAGGAGCTTCCGGATCCTAGTGGAGTCT
CAGAATCGTGGAGTGGCCGTGGGTGTGGCTTTCCACTATCACCTGCAAAGAGTTTTTTGG
ACAGACACCGTGCAAAATAAGGTTTTTTCAGTTGACATTAATGGTTTAAATATCCAAGAG
GTTCTCAATGTTTCTGTTGAAACCCCAGAGAACCTGGCTGTGGACTGGGTTAATAATAAA
ATCTATCTAGTGGAAACCAAGGTCAACCGCATAGATATGGTAAATTTGGATGGAAGCTAT
CGGGTTACCCTTATAACTGAAAACTTGGGGCATCCTAGAGGAATTGCCGTGGACCCAACT
GTTGGTTATTTATTTTTCTCAGATTGGGAGAGCCTTTCTGGGGAACCTAAGCTGGAAAGG
GCATTCATGGATGGCAGCAACCGTAAAGACTTGGTGAAAACAAAGCTGGGATGGCCTGCT
GGGGTAACTCTGGATATGATATCGAAGCGTGTTTACTGGGTTGACTCTCGGTTTGATTAC
ATTGAAACTGTAACTTATGATGGAATTCAAAGGAAGACTGTAGTTCATGGAGGCTCCCTC
ATTCCTCATCCCTTTGGAGTAAGCTTATTTGAAGGTCAGGTGTTCTTTACAGATTGGACA
AAGATGGCCGTGCTGAAGGCAAACAAGTTCACAGAGACCAACCCACAAGTGTACTACCAG
GCTTCCCTGAGGCCCTATGGAGTGACTGTTTACCATTCCCTCAGACAGCCCTATGCTACC
AATCCGTGTAAAGATAACAATGGGGGCTGTGAGCAGGTCTGTGTCCTCAGCCACAGAACA
GATAATGATGGTTTGGGTTTCCGTTGCAAGTGCACATTCGGCTTCCAACTGGATACAGAT
GAGCGCCACTGCATTGCTGTTCAGAATTTCCTCATTTTTTCATCCCAAGTTGCTATTCGT
GGGATCCCGTTCACCTTGTCTACCCAGGAAGATGTCATGGTTCCAGTTTCGGGGAATCCT
TCTTTCTTTGTCGGGATTGATTTTGACGCCCAGGACAGCACTATCTTTTTTTCAGATATG
TCAAAACACATGATTTTTAAGCAAAAGATTGATGGCACAGGAAGAGAAATTCTCGCAGCT
AACAGGGTGGAAAATGTTGAAAGTTTGGCTTTTGATTGGATTTCAAAGAATCTCTATTGG
ACAGACTCTCATTACAAGAGTATCAGTGTCATGAGGCTAGCTGATAAAACGAGACGCACA
GTAGTTCAGTATTTAAATAACCCACGGTCGGTGGTAGTTCATCCTTTTGCCGGGTATCTA
TTCTTCACTGATTGGTTCCGTCCTGCTAAAATTATGAGAGCATGGAGTGACGGATCTCAC
CTCTTGCCTGTAATAAACACTACTCTTGGATGGCCCAATGGCTTGGCCATCGATTGGGCT
GCTTCACGATTGTACTGGGTAGATGCCTATTTTGATAAAATTGAGCACAGCACCTTTGAT
GGTTTAGACAGAAGAAGACTGGGCCATATAGAGCAGATGACACATCCGTTTGGACTTGCC
ATCTTTGGAGAGCATTTATTTTTTACTGACTGGAGACTGGGTGCCATTATTCGAGTCAGG
AAAGCAGATGGTGGAGAAATGACAGTTATCCGAAGTGGCATTGCTTACATACTGCATTTG
AAATCGTATGATGTCAACATCCAGACTGGTTCTAACGCCTGTAATCAACCCACGCATCCT
AACGGTGACTGCAGCCACTTCTGCTTCCCGGTGCCAAATTTCCAGCGAGTGTGTGGGTGC
CCTTATGGAATGAGGCTGGCTTCCAATCACTTGACATGCGAGGGGGACCCAACCAATGAA
CCACCCACAGAGCAGTGTGGCTTATTTTCCTTCCCCTGTAAAAATGGCAGATGTGTGCCC
AATTACTATCTCTGTGATGGAGTCGATGATTGTCATGATAACAGTGATGAGCAACTATGT
GGCACACTTAATAATACCTGTTCATCTTCGGCGTTCACCTGTGGCCATGGGGAGTGCATT
CCTGCACACTGGCGCTGTGACAAACGCAACGACTGTGTGGATGGCAGTGATGAGCACAAC
TGCCCCACCCACGCACCTGCTTCCTGCCTTGACACCCAATACACCTGTGATAATCACCAG
TGTATCTCAAAGAACTGGGTCTGTGACACAGACAATGATTGTGGGGATGGATCTGATGAA
AAGAACTGCAATTCGACAGAGACATGCCAACCTAGTCAGTTTAATTGCCCCAATCATCGA
TGTATTGACCTATCGTTTGTCTGTGATGGTGACAAGGATTGTGTTGATGGATCTGATGAG
GTTGGTTGTGTATTAAACTGTACTGCTTCTCAATTCAAGTGTGCCAGTGGGGATAAATGT
ATTGGCGTCACAAATCGTTGTGATGGTGTTTTTGATTGCAGTGACAACTCGGATGAAGCA
GGCTGTCCAACCAGGCCTCCTGGTATGTGCCACTCAGATGAATTTCAGTGCCAAGAAGAT
GGTATCTGCATCCCGAACTTCTGGGAATGTGATGGGCATCCAGACTGCCTCTATGGATCT
GATGAGCACAATGCCTGTGTCCCCAAGACTTGCCCTTCATCATATTTCCACTGTGACAAC
GGAAACTGCATCCACAGGGCATGGCTCTGTGATCGGGACAATGACTGCGGGGATATGAGT
GATGAGAAGGACTGCCCTACTCAGCCCTTTCGCTGTCCTAGTTGGCAATGGCAGTGTCTT
GGCCATAACATCTGTGTGAATCTGAGTGTAGTGTGTGATGGCATCTTTGACTGCCCCAAT
GGGACAGATGAGTCCCCACTTTGCAATGGGAACAGCTGCTCAGATTTCAATGGTGGTTGT
ACTCACGAGTGTGTTCAAGAGCCCTTTGGGGCTAAATGCCTATGTCCATTGGGATTCTTA
CTTGCCAATGATTCTAAGACCTGTGAAGACATAGATGAATGTGATATTCTAGGCTCTTGT
AGCCAGCACTGTTACAATATGAGAGGTTCTTTCCGGTGCTCGTGTGATACAGGCTACATG
TTAGAAAGTGATGGGAGGACTTGCAAAGTTACAGCATCTGAGAGTCTGCTGTTACTTGTG
GCAAGTCAGAACAAAATTATTGCCGACAGTGTCACCTCCCAGGTCCACAATATCTATTCA
TTGGTCGAGAATGGTTCTTACATTGTAGCTGTTGATTTTGATTCAATTAGTGGTCGTATC
TTTTGGTCTGATGCAACTCAGGGTAAAACCTGGAGTGCGTTTCAAAATGGAACGGACAGA
AGAGTGGTATTTGACAGTAGCATCATCTTGACTGAAACTATTGCAATAGATTGGGTAGGT
CGTAATCTTTACTGGACAGACTATGCTCTGGAAACAATTGAAGTCTCCAAAATTGATGGG
AGCCACAGGACTGTGCTGATTAGTAAAAACCTAACAAATCCAAGAGGACTAGCATTAGAT
CCCAGAATGAATGAGCATCTACTGTTCTGGTCTGACTGGGGCCACCACCCTCGCATCGAG
CGAGCCAGCATGGACGGCAGCATGCGCACTGTCATTGTCCAGGACAAGATCTTCTGGCCC
TGCGGCTTAACTATTGACTACCCCAACAGACTGCTCTACTTCATGGACTCCTATCTTGAT
TACATGGACTTTTGTGATTATAATGGACACCATCGGAGACAGGTGATAGCCAGTGATTTG
ATTATACGGCACCCCTATGCCCTAACTCTCTTTGAAGACTCTGTGTACTGGACTGACCGT
GCTACTCGTCGGGTTATGCGAGCCAACAAGTGGCATGGAGGGAACCAGTCAGTTGTAATG
TATAATATTCAATGGCCCCTTGGGATTGTTGCGGTTCATCCTTCGAAACAACCAAATTCC
GTGAATCCATGTGCCTTTTCCCGCTGCAGCCATCTCTGCCTGCTTTCCTCACAGGGGCCT
CATTTTTACTCCTGTGTTTGTCCTTCAGGATGGAGTCTGTCTCCTGATCTCCTGAATTGC
TTGAGAGATGATCAACCTTTCTTAATAACTGTAAGGCAACATATAATTTTTGGAATCTCC
CTTAATCCTGAGGTGAAGAGCAATGATGCTATGGTCCCCATAGCAGGGATACAGAATGGT
TTAGATGTTGAATTTGATGATGCTGAGCAATACATCTATTGGGTTGAAAATCCAGGTGAA
ATTCACAGAGTGAAGACAGATGGCACCAACAGGACAGTATTTGCTTCTATATCTATGGTG
GGGCCTTCTATGAACCTGGCCTTAGATTGGATTTCAAGAAACCTTTATTCTACCAATCCT
AGAACTCAGTCAATCGAGGTTTTGACACTCCACGGAGATATCAGATACAGAAAAACATTG
ATTGCCAATGATGGGACAGCTCTTGGAGTTGGCTTTCCAATTGGCATAACTGTTGATCCT
GCTCGTGGGAAGCTGTACTGGTCAGACCAAGGAACTGACAGTGGGGTTCCTGCCAAGATC
GCCAGTGCTAACATGGATGGCACATCTGTGAAAACTCTCTTTACTGGGAACCTCGAACAC
CTGGAGTGTGTCACTCTTGACATCGAAGAGCAGAAACTCTACTGGGCAGTCACTGGAAGA
GGAGTGATTGAAAGAGGAAACGTGGATGGAACAGATCGAATGATCCTGGTACACCAGCTT
TCCCACCCCTGGGGAATTGCAGTCCATGATTCTTTCCTTTATTATACTGATGAACAGTAT
GAGGTCATTGAAAGAGTTGATAAGGCCACTGGGGCCAACAAAATAGTCTTGAGAGATAAT
GTTCCAAATCTGAGGGGTCTTCAAGTTTATCACAGACGCAATGCCGCCGAATCCTCAAAT
GGCTGTAGCAACAACATGAATGCCTGTCAGCAGATTTGCCTGCCTGTACCAGGAGGATTG
TTTTCCTGCGCCTGTGCCACTGGATTTAAACTCAATCCTGATAATCGGTCCTGCTCTCCA
TATAACTCTTTCATTGTTGTTTCAATGCTGTCTGCAATCAGAGGCTTTAGCTTGGAATTG
TCAGATCATTCAGAAACCATGGTGCCGGTGGCAGGCCAAGGACGAAACGCACTGCATGTG
GATGTGGATGTGTCCTCTGGCTTTATTTATTGGTGTGATTTTAGCAGCTCAGTGGCATCT
GATAATGCGATCCGTAGAATTAAACCAGATGGATCTTCTCTGATGAACATTGTGACACAT
GGAATAGGAGAAAATGGAGTCCGGGGTATTGCAGTGGATTGGGTAGCAGGAAATCTTTAT
TTCACCAATGCCTTTGTTTCTGAAACACTGATAGAAGTTCTGCGGATCAATACTACTTAC
CGCCGTGTTCTTCTTAAAGTCACAGTGGACATGCCTAGGCATATTGTTGTAGATCCCAAG
AACAGATACCTCTTCTGGGCTGACTATGGGCAGAGACCAAAGATTGAGCGTTCTTTCCTT
GACTGTACCAATCGAACAGTGCTTGTGTCAGAGGGCATTGTCACACCACGGGGCTTGGCA
GTGGACCGAAGTGATGGCTACGTTTATTGGGTTGATGATTCTTTAGATATAATTGCAAGG
ATTCGTATCAATGGAGAGAACTCTGAAGTGATTCGTTATGGCAGTCGTTACCCAACTCCT
TATGGCATCACTGTTTTTGAAAATTCTATCATATGGGTAGATAGGAATTTGAAAAAGATC
TTCCAAGCCAGCAAGGAACCAGAGAACACAGAGCCACCCACAGTGATAAGAGACAATATC
AACTGGCTAAGAGATGTGACCATCTTTGACAAGCAAGTCCAGCCCCGGTCACCAGCAGAG
GTCAACAACAACCCTTGCTTGGAAAACAATGGTGGGTGCTCTCATCTCTGCTTTGCTCTG
CCTGGATTGCACACCCCAAAATGTGACTGTGCCTTTGGGACCCTGCAAAGTGATGGCAAG
AATTGTGCCATTTCAACAGAAAATTTCCTCATCTTTGCCTTGTCTAATTCCTTGAGAAGC
TTACACTTGGACCCTGAAAACCATAGCCCACCTTTCCAAACAATAAATGTGGAAAGAACT
GTCATGTCTCTAGACTATGACAGTGTAAGTGATAGAATCTACTTCACACAAAATTTAGCC
TCTGGAGTTGGACAGATTTCCTATGCCACCCTGTCTTCAGGGATCCATACTCCAACTGTC
ATTGCTTCAGGTATAGGGACTGCTGATGGCATTGCCTTTGACTGGATTACTAGAAGAATT
TATTACAGTGACTACCTCAACCAGATGATTAATTCCATGGCTGAAGATGGGTCTAACCGC
ACTGTGATAGCCCGCGTTCCAAAACCAAGAGCAATTGTGTTAGATCCCTGCCAAGGGTAC
CTGTACTGGGCTGACTGGGATACACATGCCAAAATCGAGAGAGCCACATTGGGAGGAAAC
TTCCGCGTACCCATTGTGAACAGCAGTCTGGTCATGCCCAGTGGGCTGACTCTGGACTAT
GAAGAGGACCTTCTCTACTGGGTGGATGCTAGTCTGCAGAGGATTGAACGCAGCACTCTG
ACGGGCGTGGATCGTGAAGTCATTGTCAATGCAGCCGTTCATGCTTTTGGCTTGACTCTC
TATGGCCAGTATATTTACTGGACTGACTTGTACACACAAAGAATTTACCGAGCTAACAAA
TATGACGGGTCAGGTCAGATTGCAATGACCACAAATTTGCTCTCCCAGCCCAGGGGAATC
AACACTGTTGTGAAGAACCAGAAACAACAGTGTAACAATCCTTGTGAACAGTTTAATGGG
GGCTGCAGCCATATCTGTGCACCAGGTCCAAATGGTGCCGAGTGCCAGTGTCCACATGAG
GGCAACTGGTATTTGGCCAACAACAGGAAGCACTGCATTGTGGACAATGGTGAACGATGT
GGTGCATCTTCCTTCACCTGCTCCAATGGGCGCTGCATCTCGGAAGAGTGGAAGTGTGAT
AATGACAACGACTGTGGGGATGGCAGTGATGAGATGGAAAGTGTCTGTGCACTTCACACC
TGCTCACCGACAGCCTTCACCTGTGCCAATGGGCGATGTGTCCAATACTCTTACCGCTGT
GATTACTACAATGACTGTGGTGATGGCAGTGATGAGGCAGGGTGCCTGTTCAGGGACTGC
AATGCCACCACGGAGTTTATGTGCAATAACAGAAGGTGCATACCTCGTGAGTTTATCTGC
AATGGTGTAGACAACTGCCATGATAATAACACTTCAGATGAGAAAAATTGCCCTGATCGC
ACTTGCCAGTCTGGATACACAAAATGTCATAATTCAAATATTTGTATTCCTCGCGTTTAT
TTGTGTGACGGAGACAATGACTGTGGAGATAACAGTGATGAAAACCCTACTTATTGCACC
ACTCACACGTGCAGCAGCAGTGAGTTCCAATGCGCATCTGGGCGCTGTATTCCTCAACAT
TGGTATTGTGATCAAGAAACAGATTGTTTTGATGCCTCTGATGAACCTGCCTCTTGTGGT
CACTCTGAGCGAACATGCCTAGCTGATGAGTTCAAGTGTGATGGTGGGAGGTGCATCCCA
AGCGAATGGATCTGTGACGGTGATAATGACTGTGGGGATATGAGTGACGAGGATAAAAGG
CACCAGTGTCAGAATCAAAACTGCTCGGATTCCGAGTTTCTCTGTGTAAATGACAGACCT
CCGGACAGGAGGTGCATTCCCCAGTCTTGGGTCTGTGATGGCGATGTGGATTGTACTGAC
GGCTACGATGAGAATCAGAATTGCACCAGGAGAACTTGCTCTGAAAATGAATTCACCTGT
GGTTACGGACTGTGTATCCCAAAGATATTCAGGTGTGACCGGCACAATGACTGTGGTGAC
TATAGCGACGAGAGGGGCTGCTTATACCAGACTTGCCAACAGAATCAGTTTACCTGTCAG
AACGGGCGCTGCATTAGTAAAACCTTCGTCTGTGATGAGGATAATGACTGTGGAGACGGA
TCTGATGAGCTGATGCACCTGTGCCACACCCCAGAACCCACGTGTCCACCTCACGAGTTC
AAGTGTGACAATGGGCGCTGCATCGAGATGATGAAACTCTGCAACCACCTAGATGACTGT
TTGGACAACAGCGATGAGAAAGGCTGTGGCATTAATGAATGCCATGACCCTTCAATCAGT
GGCTGCGATCACAACTGCACAGACACCTTAACCAGTTTCTATTGTTCCTGTCGTCCTGGT
TACAAGCTCATGTCTGACAAGCGGACTTGTGTTGATATTGATGAATGCACAGAGATGCCT
TTTGTCTGTAGCCAGAAGTGTGAGAATGTAATAGGCTCCTACATCTGTAAGTGTGCCCCA
GGCTACCTCCGAGAACCAGATGGAAAGACCTGCCGGCAAAACAGTAACATCGAACCCTAT
CTCATTTTTAGCAACCGTTACTATTTGAGAAATTTAACTATAGATGGCTATTTTTACTCC
CTCATCTTGGAAGGACTGGACAATGTTGTGGCATTAGATTTTGACCGAGTAGAGAAGAGA
TTGTATTGGATTGATACACAGAGGCAAGTCATTGAGAGAATGTTTCTGAATAAGACAAAC
AAGGAGACAATCATAAACCACAGACTACCAGCTGCAGAAAGTCTGGCTGTAGACTGGGTT
TCCAGAAAGCTCTACTGGTTGGATGCCCGCCTGGATGGCCTCTTTGTCTCTGACCTCAAT
GGTGGACACCGCCGCATGCTGGCCCAGCACTGTGTGGATGCCAACAACACCTTCTGCTTT
GATAATCCCAGAGGACTTGCCCTTCACCCTCAATATGGGTACCTCTACTGGGCAGACTGG
GGTCACCGCGCATACATTGGGAGAGTAGGCATGGATGGAACCAACAAGTCTGTGATAATC
TCCACCAAGTTAGAGTGGCCTAATGGCATCACCATTGATTACACCAATGATCTACTCTAC
TGGGCAGATGCCCACCTGGGTTACATAGAGTACTCTGATTTGGAGGGCCACCATCGACAC
ACGGTGTATGATGGGGCACTGCCTCACCCTTTCGCTATTACCATTTTTGAAGACACTATT
TATTGGACAGATTGGAATACAAGGACAGTGGAAAAGGGAAACAAATATGATGGATCAAAT
AGACAGACACTGGTGAACACAACACACAGACCATTTGACATCCATGTGTACCATCCATAT
AGGCAGCCCATTGTGAGCAATCCCTGTGGTACCAACAATGGTGGCTGTTCTCATCTCTGC
CTCATCAAGCCAGGAGGAAAAGGGTTCACTTGCGAGTGTCCAGATGACTTCCGCACCCTT
CAGCTGAGTGGCAGCACCTACTGCATGCCCATGTGCTCCAGCACCCAGTTCCTGTGCGCT
AACAATGAAAAGTGCATTCCTATCTGGTGGAAATGTGATGGACAGAAAGACTGCTCAGAT
GGCTCTGATGAACTGGCCCTTTGCCCGCAGCGCTTCTGCCGACTGGGACAGTTCCAGTGC
AGTGACGGCAACTGCACCAGCCCGCAGACTTTATGCAATGCTCACCAAAATTGCCCTGAT
GGGTCTGATGAAGACCGTCTTCTTTGTGAGAATCACCACTGTGACTCCAATGAATGGCAG
TGCGCCAACAAACGTTGCATCCCAGAATCCTGGCAGTGTGACACATTTAACGACTGTGAG
GATAACTCAGATGAAGACAGTTCCCACTGTGCCAGCAGGACCTGCCGGCCGGGCCAGTTT
CGGTGTGCTAATGGCCGCTGCATCCCGCAGGCCTGGAAGTGTGATGTGGATAATGATTGT
GGAGACCACTCGGATGAGCCCATTGAAGAATGCATGAGCTCTGCCCATCTCTGTGACAAC
TTCACAGAATTCAGCTGCAAAACAAATTACCGCTGCATCCCAAAGTGGGCCGTGTGCAAT
GGTGTAGATGACTGCAGGGACAACAGTGATGAGCAAGGCTGTGAGGAGAGGACATGCCAT
CCTGTGGGGGATTTCCGCTGTAAAAATCACCACTGCATCCCTCTTCGTTGGCAGTGTGAT
GGGCAAAATGACTGTGGAGATAACTCAGATGAGGAAAACTGTGCTCCCCGGGAGTGCACA
GAGAGCGAGTTTCGATGTGTCAATCAGCAGTGCATTCCCTCGCGATGGATCTGTGACCAT
TACAACGACTGTGGGGACAACTCAGATGAACGGGACTGTGAGATGAGGACCTGCCATCCT
GAATATTTTCAGTGTACAAGTGGACATTGTGTACACAGTGAACTGAAATGCGATGGATCC
GCTGACTGTTTGGATGCGTCTGATGAAGCTGATTGTCCCACACGCTTTCCTGATGGTGCA
TACTGCCAGGCTACTATGTTCGAATGCAAAAACCATGTTTGTATCCCGCCATATTGGAAA
TGTGATGGCGATGATGACTGTGGCGATGGTTCAGATGAAGAACTTCACCTGTGCTTGGAT
GTTCCCTGTAATTCACCAAACCGTTTCCGGTGTGACAACAATCGCTGCATTTATAGTCAT
GAGGTGTGCAATGGTGTGGATGACTGTGGAGATGGAACTGATGAGACAGAGGAGCACTGT
AGAAAACCGACCCCTAAACCTTGTACAGAATATGAATATAAGTGTGGCAATGGGCATTGC
ATTCCACATGACAATGTGTGTGATGATGCCGATGACTGTGGTGACTGGTCCGATGAACTG
GGTTGCAATAAAGGAAAAGAAAGAACATGTGCTGAAAATATATGCGAGCAAAATTGTACC
CAATTAAATGAAGGAGGATTTATCTGCTCCTGTACAGCTGGGTTCGAAACCAATGTTTTT
GACAGAACCTCCTGTCTAGATATCAATGAATGTGAACAATTTGGGACTTGTCCCCAGCAC
TGCAGAAATACCAAAGGAAGTTATGAGTGTGTCTGTGCTGATGGCTTCACGTCTATGAGT
GACCGCCCTGGAAAACGATGTGCAGCTGAGGGTAGCTCTCCTTTGTTGCTACTGCCTGAC
AATGTCCGAATTCGAAAATATAATCTCTCATCTGAGAGGTTCTCAGAGTATCTTCAAGAT
GAGGAATATATCCAAGCTGTTGATTATGATTGGGATCCCAAGGACATAGGCCTCAGTGTT
GTGTATTACACTGTGCGAGGGGAGGGCTCTAGGTTTGGTGCTATCAAACGTGCCTACATC
CCCAACTTTGAATCCGGCCGCAATAATCTTGTGCAGGAAGTTGACCTGAAACTGAAATAC
GTAATGCAGCCAGATGGAATAGCAGTGGACTGGGTTGGAAGGCATATTTACTGGTCAGAT
GTCAAGAATAAACGCATTGAGGTGGCTAAACTTGATGGAAGGTACAGAAAGTGGCTGATT
TCCACTGACCTGGACCAACCAGCTGCTATTGCTGTGAATCCCAAACTAGGGCTTATGTTC
TGGACTGACTGGGGAAAGGAACCTAAAATCGAGTCTGCCTGGATGAATGGAGAGGACCGC
AACATCCTGGTTTTCGAGGACCTTGGTTGGCCAACTGGCCTTTCTATCGATTATTTGAAC
AATGACCGAATCTACTGGAGTGACTTCAAGGAGGACGTTATTGAAACCATAAAATATGAT
GGGACTGATAGGAGAGTCATTGCAAAGGAAGCAATGAACCCTTACAGCCTGGACATCTTT
GAAGACCAGTTATACTGGATATCTAAGGAAAAGGGAGAAGTATGGAAACAAAATAAATTT
GGGCAAGGAAAGAAAGAGAAAACGCTGGTAGTGAACCCTTGGCTCACTCAAGTTCGAATC
TTTCATCAACTCAGATACAATAAGTCAGTGCCCAACCTTTGCAAACAGATCTGCAGCCAC
CTCTGCCTTCTGAGACCTGGAGGATACAGCTGTGCCTGTCCCCAAGGCTCCAGCTTTATA
GAGGGGAGCACCACTGAGTGTGATGCAGCCATCGAACTGCCTATCAACCTGCCCCCCCCA
TGCAGGTGCATGCACGGAGGAAATTGCTATTTTGATGAGACTGACCTCCCCAAATGCAAG
TGTCCTAGCGGCTACACCGGAAAATATTGTGAAATGGCGTTTTCAAAAGGCATCTCTCCA
GGAACAACCGCAGTAGCTGTGCTGTTGACAATCCTCTTGATCGTCGTAATTGGAGCTCTG
GCAATTGCAGGATTCTTCCACTATAGAAGGACCGGCTCCCTTTTGCCTGCTCTGCCCAAG
CTGCCAAGCTTAAGCAGTCTCGTCAAGCCCTCTGAAAATGGGAATGGGGTGACCTTCAGA
TCAGGGGCAGATCTTAACATGGATATTGGAGTGTCTGGTTTTGGACCTGAGACTGCTATT
GACAGGTCAATGGCAATGAGTGAAGACTTTGTCATGGAAATGGGGAAGCAGCCCATAATA
TTTGAAAACCCAATGTACTCAGCCAGAGACAGTGCTGTCAAAGTGGTTCAGCCAATCCAG
GTGACTGTATCTGAAAATGTGGATAATAAGAATTATGGAAGTCCCATAAACCCTTCTGAG
ATAGTTCCAGAGACAAACCCAACTTCACCAGCTGCTGATGGAACTCAGGTGACAAAATGG
AATCTCTTCAAACGAAAATCTAAACAAACTACCAACTTTGAAAATCCAATCTATGCACAG
ATGGAGAACGAGCAAAAGGAAAGTGTTGCTGCGACACCACCTCCATCACCTTCGCTCCCT
GCTAAGCCTAAGCCTCCTTCGAGAAGAGACCCAACTCCAACCTATTCTGCAACAGAAGAC
ACTTTTAAAGACACCGCAAATCTTGTTAAAGAAGACTCTGAAGTATAG
Chromosome Location
2
Locus
2q24-q31
External Identifiers
ResourceLink
UniProtKB IDP98164
UniProtKB Entry NameLRP2_HUMAN
GenBank Protein ID1809240
GenBank Gene IDU33837
GenAtlas IDLRP2
HGNC IDHGNC:6694
General References
  1. Hjalm G, Murray E, Crumley G, Harazim W, Lundgren S, Onyango I, Ek B, Larsson M, Juhlin C, Hellman P, Davis H, Akerstrom G, Rask L, Morse B: Cloning and sequencing of human gp330, a Ca(2+)-binding receptor with potential intracellular signaling properties. Eur J Biochem. 1996 Jul 1;239(1):132-7. [PubMed:8706697]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  3. Korenberg JR, Argraves KM, Chen XN, Tran H, Strickland DK, Argraves WS: Chromosomal localization of human genes for the LDL receptor family member glycoprotein 330 (LRP2) and its associated protein RAP (LRPAP1). Genomics. 1994 Jul 1;22(1):88-93. [PubMed:7959795]
  4. Lundgren S, Hjalm G, Hellman P, Ek B, Juhlin C, Rastad J, Klareskog L, Akerstrom G, Rask L: A protein involved in calcium sensing of the human parathyroid and placental cytotrophoblast cells belongs to the LDL-receptor protein superfamily. Exp Cell Res. 1994 Jun;212(2):344-50. [PubMed:8187828]
  5. Kounnas MZ, Loukinova EB, Stefansson S, Harmony JA, Brewer BH, Strickland DK, Argraves WS: Identification of glycoprotein 330 as an endocytic receptor for apolipoprotein J/clusterin. J Biol Chem. 1995 Jun 2;270(22):13070-5. [PubMed:7768901]
  6. Oleinikov AV, Zhao J, Makker SP: Cytosolic adaptor protein Dab2 is an intracellular ligand of endocytic receptor gp600/megalin. Biochem J. 2000 May 1;347 Pt 3:613-21. [PubMed:10769163]
  7. Petersen HH, Hilpert J, Militz D, Zandler V, Jacobsen C, Roebroek AJ, Willnow TE: Functional interaction of megalin with the megalinbinding protein (MegBP), a novel tetratrico peptide repeat-containing adaptor molecule. J Cell Sci. 2003 Feb 1;116(Pt 3):453-61. [PubMed:12508107]
  8. Gallagher H, Oleinikov AV, Fenske C, Newman DJ: The adaptor disabled-2 binds to the third psi xNPxY sequence on the cytoplasmic tail of megalin. Biochimie. 2004 Mar;86(3):179-82. [PubMed:15134832]
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]
  10. Kantarci S, Al-Gazali L, Hill RS, Donnai D, Black GC, Bieth E, Chassaing N, Lacombe D, Devriendt K, Teebi A, Loscertales M, Robson C, Liu T, MacLaughlin DT, Noonan KM, Russell MK, Walsh CA, Donahoe PK, Pober BR: Mutations in LRP2, which encodes the multiligand receptor megalin, cause Donnai-Barrow and facio-oculo-acoustico-renal syndromes. Nat Genet. 2007 Aug;39(8):957-9. Epub 2007 Jul 15. [PubMed:17632512]
  11. Varela I, Tarpey P, Raine K, Huang D, Ong CK, Stephens P, Davies H, Jones D, Lin ML, Teague J, Bignell G, Butler A, Cho J, Dalgliesh GL, Galappaththige D, Greenman C, Hardy C, Jia M, Latimer C, Lau KW, Marshall J, McLaren S, Menzies A, Mudie L, Stebbings L, Largaespada DA, Wessels LF, Richard S, Kahnoski RJ, Anema J, Tuveson DA, Perez-Mancera PA, Mustonen V, Fischer A, Adams DJ, Rust A, Chan-on W, Subimerb C, Dykema K, Furge K, Campbell PJ, Teh BT, Stratton MR, Futreal PA: Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma. Nature. 2011 Jan 27;469(7331):539-42. doi: 10.1038/nature09639. Epub 2011 Jan 19. [PubMed:21248752]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00798Gentamicinapproved, vet_approvednoother/unknownDetails
DB00013Urokinaseapproved, investigational, withdrawnunknownDetails
DB00071Insulin porkapprovedunknownDetails
DB00115Cyanocobalaminapproved, nutraceuticalunknownDetails