Decaprenyl diphosphate synthase

Details

Name
Decaprenyl diphosphate synthase
Synonyms
  • 2.5.1.86
  • DecaPP
  • Decaprenyl pyrophosphate synthase
  • Long-chain isoprenyl diphosphate synthase
  • Trans,polycis-decaprenyl diphosphate synthase
Gene Name
uppS
Organism
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Amino acid sequence
>lcl|BSEQ0051253|Decaprenyl diphosphate synthase
MARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAP
RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAF
STENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEM
TKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVD
LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
Number of residues
296
Molecular Weight
33790.985
Theoretical pI
Not Available
GO Classification
Functions
di-trans,poly-cis-decaprenylcistransferase activity / magnesium ion binding / manganese ion binding / polyprenyltransferase activity / trans-octaprenyltranstransferase activity / Z-farnesyl diphosphate synthase activity
Processes
growth / polyprenol biosynthetic process
Components
cytosol / plasma membrane
General Function
Catalyzes the sequential condensation of isopentenyl diphosphate (IPP) in the cis configuration with (2Z,6E)-farnesyl diphosphate (Z-FPP or EZ-FPP) generating the 50 carbon product trans,polycis-decaprenyl diphosphate. When (2E,6E)-farnesyl diphosphate (E-FPP or EE-FPP) is used in vitro, both primary products decaprenyl diphosphate and (2E,6E,10E)-geranylgeranyl diphosphate (EEE-GGPP) are synthesized. M.tuberculosis does not synthesize (2E,6E,10Z)-geranylgeranyl diphosphate (EEZ-GGPP) and heptaprenyl diphosphate. Can also accept many different allylic substrates, including E-geranyl diphosphate (E-GPP), neryl diphosphate (NPP), and all-trans-geranyl-geranyl diphosphate.
Specific Function
Di-trans,poly-cis-decaprenylcistransferase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0051254|Decaprenyl diphosphate synthase (uppS)
GTGGCTAGGGATGCACGGAAGCGGACGTCCAGCAACTTCCCGCAGCTGCCTCCGGCCCCC
GACGACTACCCGACCTTTCCTGATACGTCGACGTGGCCCGTCGTCTTCCCGGAGTTGCCG
GCAGCGCCCTACGGAGGCCCCTGCCGGCCACCGCAGCACACTTCGAAAGCGGCCGCGCCA
CGAATACCGGCCGACCGGCTGCCCAACCATGTCGCCATTGTCATGGACGGCAATGGCCGC
TGGGCCACCCAACGTGGGCTGGCCCGCACCGAAGGTCACAAGATGGGCGAGGCGGTGGTG
ATCGACATCGCTTGCGGTGCTATCGAACTTGGGATCAAGTGGCTCAGCCTCTACGCCTTC
TCCACGGAGAACTGGAAGCGTTCGCCCGAGGAAGTCCGCTTCCTGATGGGCTTCAACCGC
GACGTGGTGCGACGGCGCCGAGACACCCTAAAGAAGCTAGGGGTCCGGATCCGGTGGGTG
GGTTCACGACCACGGCTGTGGCGTAGCGTCATCAATGAGTTGGCGGTCGCGGAGGAGATG
ACCAAAAGCAACGACGTCATCACCATCAACTATTGCGTCAACTACGGCGGACGCACCGAA
ATCACCGAAGCCACCCGCGAAATCGCTCGTGAGGTCGCCGCGGGCAGGCTCAACCCGGAG
CGGATCACCGAATCCACGATCGCCCGCCACCTGCAGCGACCCGACATTCCCGACGTTGAC
CTCTTCCTGCGGACCTCGGGTGAGCAGCGCTCCAGCAACTTCATGCTGTGGCAGGCGGCC
TACGCTGAATACATATTCCAGGACAAGCTCTGGCCCGACTATGACCGCCGCGACTTGTGG
GCGGCCTGCGAGGAATACGCGTCGCGCACTCGGCGGTTCGGGAGCGCCTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP9WFF7
UniProtKB Entry NameDPDS_MYCTU
General References
  1. Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [PubMed:9634230]
  2. Crick DC, Schulbach MC, Zink EE, Macchia M, Barontini S, Besra GS, Brennan PJ: Polyprenyl phosphate biosynthesis in Mycobacterium tuberculosis and Mycobacterium smegmatis. J Bacteriol. 2000 Oct;182(20):5771-8. [PubMed:11004176]
  3. Schulbach MC, Brennan PJ, Crick DC: Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J Biol Chem. 2000 Jul 28;275(30):22876-81. [PubMed:10816587]
  4. Kaur D, Brennan PJ, Crick DC: Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J Bacteriol. 2004 Nov;186(22):7564-70. [PubMed:15516568]
  5. Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [PubMed:21969609]
  6. Wang W, Dong C, McNeil M, Kaur D, Mahapatra S, Crick DC, Naismith JH: The structural basis of chain length control in Rv1086. J Mol Biol. 2008 Aug 1;381(1):129-40. doi: 10.1016/j.jmb.2008.05.060. Epub 2008 Jul 1. [PubMed:18597781]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02552Geranyl DiphosphateexperimentalunknownDetails
DB04714ISOPENTENYL PYROPHOSPHATEexperimentalunknownDetails