Group 1 truncated hemoglobin GlbN
Details
- Name
- Group 1 truncated hemoglobin GlbN
- Synonyms
- Hemoglobin-like protein HbN
- Truncated hemoglobin
- Gene Name
- glbN
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- Amino acid sequence
>lcl|BSEQ0051144|Group 1 truncated hemoglobin GlbN MGLLSRLRKREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVE FFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIA PLAVDVTSGESTTAPV
- Number of residues
- 136
- Molecular Weight
- 14448.445
- Theoretical pI
- Not Available
- GO Classification
- Functionsheme binding / metal ion binding / nitric oxide dioxygenase activity / oxygen binding / oxygen transporter activityProcessesdetoxification of nitrogen compound / evasion or tolerance by symbiont of host-produced nitric oxide / nitric oxide catabolic processComponentscytosol
- General Function
- Binds oxygen cooperatively with very high affinity (P(50) = 0.013 mmHg at 20 degrees Celsius) because of a fast combination (25 microM(-1).s(-1)) and a slow dissociation (0.2 s(-1)) rate.
- Specific Function
- Heme binding
- Pfam Domain Function
- Bac_globin (PF01152)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0051145|Group 1 truncated hemoglobin GlbN (glbN) ATGGGACTACTGTCACGCTTGCGCAAACGTGAGCCGATCAGCATCTACGACAAGATCGGC GGGCATGAGGCCATCGAAGTCGTCGTCGAGGACTTCTATGTTCGTGTGCTTGCCGATGAC CAACTATCGGCCTTCTTCAGCGGTACGAACATGAGCCGCCTCAAGGGCAAGCAGGTGGAG TTTTTCGCGGCCGCGCTTGGCGGGCCCGAGCCCTATACCGGTGCGCCGATGAAGCAAGTC CATCAGGGGCGCGGAATTACCATGCACCACTTCAGCCTGGTCGCCGGACACTTGGCCGAC GCGCTGACCGCAGCCGGCGTGCCCTCCGAAACGATCACGGAAATCCTCGGCGTCATCGCG CCGCTGGCGGTCGACGTCACATCGGGCGAGAGCACCACGGCACCAGTCTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WN25 UniProtKB Entry Name TRHBN_MYCTU - General References
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Yeh SR, Couture M, Ouellet Y, Guertin M, Rousseau DL: A cooperative oxygen binding hemoglobin from Mycobacterium tuberculosis. Stabilization of heme ligands by a distal tyrosine residue. J Biol Chem. 2000 Jan 21;275(3):1679-84. [Article]
- Raman K, Yeturu K, Chandra N: targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis. BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109. [Article]
- Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [Article]
- Milani M, Pesce A, Ouellet Y, Ascenzi P, Guertin M, Bolognesi M: Mycobacterium tuberculosis hemoglobin N displays a protein tunnel suited for O2 diffusion to the heme. EMBO J. 2001 Aug 1;20(15):3902-9. [Article]
- Milani M, Ouellet Y, Ouellet H, Guertin M, Boffi A, Antonini G, Bocedi A, Mattu M, Bolognesi M, Ascenzi P: Cyanide binding to truncated hemoglobins: a crystallographic and kinetic study. Biochemistry. 2004 May 11;43(18):5213-21. [Article]
- Milani M, Pesce A, Ouellet Y, Dewilde S, Friedman J, Ascenzi P, Guertin M, Bolognesi M: Heme-ligand tunneling in group I truncated hemoglobins. J Biol Chem. 2004 May 14;279(20):21520-5. Epub 2004 Mar 11. [Article]
- Ouellet Y, Milani M, Couture M, Bolognesi M, Guertin M: Ligand interactions in the distal heme pocket of Mycobacterium tuberculosis truncated hemoglobin N: roles of TyrB10 and GlnE11 residues. Biochemistry. 2006 Jul 25;45(29):8770-81. [Article]