2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

Details

Name
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Synonyms
  • 2.7.6.3
  • 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
  • 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
  • HPPK
  • PPPK
Gene Name
folK
Organism
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Amino acid sequence
>lcl|BSEQ0051181|2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
MTRVVLSVGSNLGDRLARLRSVADGLGDALIAASPIYEADPWGGVEQGQFLNAVLIADDP
TCEPREWLRRAQEFERAAGRVRGQRWGPRNLDVDLIACYQTSATEALVEVTARENHLTLP
HPLAHLRAFVLIPWIAVDPTAQLTVAGCPRPVTRLLAELEPADRDSVRLFRPSFDLNSRH
PVSRAPES
Number of residues
188
Molecular Weight
20731.305
Theoretical pI
Not Available
GO Classification
Functions
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity / ATP binding / kinase activity
Processes
folic acid biosynthetic process / tetrahydrofolate biosynthetic process
General Function
Not Available
Specific Function
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0051182|2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK)
ATGACGCGGGTAGTGCTCTCGGTTGGCTCCAACCTGGGTGACCGCCTGGCACGATTGCGG
TCGGTCGCCGACGGTCTCGGCGATGCGTTGATTGCGGCTTCCCCGATATATGAGGCCGAC
CCCTGGGGTGGGGTGGAGCAGGGGCAGTTCCTCAATGCGGTGCTGATCGCCGACGATCCT
ACCTGCGAACCGCGGGAGTGGCTGCGGCGGGCGCAGGAGTTCGAGCGCGCTGCGGGCAGG
GTGCGTGGCCAGCGCTGGGGTCCACGAAATCTCGACGTCGACCTGATCGCCTGCTACCAG
ACCTCGGCCACCGAGGCTCTGGTCGAAGTGACCGCGCGGGAGAACCACCTCACGCTGCCG
CACCCACTGGCGCATCTGCGGGCCTTTGTGTTGATCCCGTGGATTGCCGTCGACCCAACG
GCGCAGCTGACGGTTGCCGGGTGCCCGCGGCCCGTCACGCGACTGCTGGCCGAGCTGGAG
CCCGCCGACCGCGACAGTGTGCGGTTGTTTAGGCCGTCGTTCGATCTGAATAGCAGACAC
CCCGTCAGTCGGGCACCGGAAAGCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP9WNC7
UniProtKB Entry NameHPPK_MYCTU
General References
  1. Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [PubMed:9634230]
  2. Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [PubMed:21969609]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00233Aminosalicylic AcidapprovedunknownunknownDetails