Nuclear factor NF-kappa-B p100 subunit

Details

Name
Nuclear factor NF-kappa-B p100 subunit
Synonyms
  • DNA-binding factor KBF2
  • H2TF1
  • Lymphocyte translocation chromosome 10 protein
  • LYT10
  • Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
  • Oncogene Lyt-10
Gene Name
NFKB2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004689|Nuclear factor NF-kappa-B p100 subunit
MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN
VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGP
EKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
Number of residues
900
Molecular Weight
96748.355
Theoretical pI
6.2
GO Classification
Functions
chromatin binding / RNA polymerase II core promoter proximal region sequence-specific DNA binding / transcription coactivator activity / transcription factor activity, sequence-specific DNA binding / transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
Processes
aging / extracellular matrix organization / follicular dendritic cell differentiation / germinal center formation / I-kappaB kinase/NF-kappaB signaling / inflammatory response / innate immune response / MyD88-dependent toll-like receptor signaling pathway / MyD88-independent toll-like receptor signaling pathway / negative regulation of transcription from RNA polymerase II promoter / NIK/NF-kappaB signaling / positive regulation of NF-kappaB transcription factor activity / positive regulation of transcription from RNA polymerase II promoter / positive regulation of type I interferon production / regulation of transcription, DNA-templated / response to cytokine / response to lipopolysaccharide / rhythmic process / spleen development / stimulatory C-type lectin receptor signaling pathway / toll-like receptor 10 signaling pathway / toll-like receptor 2 signaling pathway / toll-like receptor 3 signaling pathway / toll-like receptor 4 signaling pathway / toll-like receptor 5 signaling pathway / toll-like receptor 9 signaling pathway / toll-like receptor signaling pathway / toll-like receptor TLR1 / toll-like receptor TLR6 / transcription from RNA polymerase II promoter / TRIF-dependent toll-like receptor signaling pathway / tumor necrosis factor-mediated signaling pathway
Components
Bcl3/NF-kappaB2 complex / cytoplasm / cytosol / nucleoplasm / nucleus
General Function
Transcriptional activator activity, rna polymerase ii core promoter proximal region sequence-specific binding
Specific Function
NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. In a non-canonical activation pathway, the MAP3K14-activated CHUK/IKKA homodimer phosphorylates NFKB2/p100 associated with RelB, inducing its proteolytic processing to NFKB2/p52 and the formation of NF-kappa-B RelB-p52 complexes. The NF-kappa-B heterodimeric RelB-p52 complex is a transcriptional activator. The NF-kappa-B p52-p52 homodimer is a transcriptional repressor. NFKB2 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p100 and generation of p52 by a cotranslational processing. The proteasome-mediated process ensures the production of both p52 and p100 and preserves their independent function. p52 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. p52 and p100 are respectively the minor and major form; the processing of p100 being relatively poor. Isoform p49 is a subunit of the NF-kappa-B protein complex, which stimulates the HIV enhancer in synergy with p65. In concert with RELB, regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0016775|Nuclear factor NF-kappa-B p100 subunit (NFKB2)
ATGGAGAGTTGCTACAACCCAGGTCTGGATGGTATTATTGAATATGATGATTTCAAATTG
AACTCCTCCATTGTGGAACCCAAGGAGCCAGCCCCAGAAACAGCTGATGGCCCCTACCTG
GTGATCGTGGAACAGCCTAAGCAGAGAGGCTTCCGATTTCGATATGGCTGTGAAGGCCCC
TCCCATGGAGGACTGCCCGGTGCCTCCAGTGAGAAGGGCCGAAAGACCTATCCCACTGTC
AAGATCTGTAACTACGAGGGACCAGCCAAGATCGAGGTGGACCTGGTAACACACAGTGAC
CCACCTCGTGCTCATGCCCACAGTCTGGTGGGCAAGCAATGCTCGGAGCTGGGGATCTGC
GCCGTTTCTGTGGGGCCCAAGGACATGACTGCCCAATTTAACAACCTGGGTGTCCTGCAT
GTGACTAAGAAGAACATGATGGGGACTATGATACAAAAACTTCAGAGGCAGCGGCTCCGC
TCTAGGCCCCAGGGCCTTACGGAGGCCGAGCAGCGGGAGCTGGAGCAAGAGGCCAAAGAA
CTGAAGAAGGTGATGGATCTGAGTATAGTGCGGCTGCGCTTCTCTGCCTTCCTTAGAGCC
AGTGATGGCTCCTTCTCCCTGCCCCTGAAGCCAGTCATCTCCCAGCCCATCCATGACAGC
AAATCTCCGGGGGCATCAAACCTGAAGATTTCTCGAATGGACAAGACAGCAGGCTCTGTG
CGGGGTGGAGATGAAGTTTATCTGCTTTGTGACAAGGTGCAGAAAGATGACATTGAGGTT
CGGTTCTATGAGGATGATGAGAATGGATGGCAGGCCTTTGGGGACTTCTCTCCCACAGAT
GTGCATAAACAGTATGCCATTGTGTTCCGGACACCCCCCTATCACAAGATGAAGATTGAG
CGGCCTGTAACAGTGTTTCTGCAACTGAAACGCAAGCGAGGAGGGGACGTGTCTGATTCC
AAACAGTTCACCTATTACCCTCTGGTGGAAGACAAGGAAGAGGTGCAGCGGAAGCGGAGG
AAGGCCTTGCCCACCTTCTCCCAGCCCTTCGGGGGTGGCTCCCACATGGGTGGAGGCTCT
GGGGGTGCAGCCGGGGGCTACGGAGGAGCTGGAGGAGGTGGCAGCCTCGGTTTCTTCCCC
TCCTCCCTGGCCTACAGCCCCTACCAGTCCGGCGCGGGCCCCATGGGCTGCTACCCGGGA
GGCGGGGGCGGGGCGCAGATGGCCGCCACGGTGCCCAGCAGGGACTCCGGGGAGGAAGCC
GCGGAGCCGAGCGCCCCCTCCAGGACCCCCCAGTGCGAGCCGCAGGCCCCGGAGATGCTG
CAGCGAGCTCGAGAGTACAACGCGCGCCTGTTCGGCCTGGCGCAGCGCAGCGCCCGAGCC
CTACTCGACTACGGCGTCACCGCGGACGCGCGCGCGCTGCTGGCGGGACAGCGCCACCTG
CTGACGGCGCAGGACGAGAACGGAGACACACCACTGCACCTAGCCATCATCCACGGGCAG
ACCAGTGTCATTGAGCAGATAGTCTATGTCATCCACCACGCCCAGGACCTCGGCGTTGTC
AACCTCACCAACCACCTGCACCAGACGCCCCTGCACCTGGCGGTGATCACGGGGCAGACG
AGTGTGGTGAGCTTTCTGCTGCGGGTAGGTGCAGACCCAGCTCTGCTGGATCGGCATGGA
GACTCAGCCATGCATCTGGCGCTGCGGGCAGGCGCTGGTGCTCCTGAGCTGCTGCGTGCA
CTGCTTCAGAGTGGAGCTCCTGCTGTGCCCCAGCTGTTGCATATGCCTGACTTTGAGGGA
CTGTATCCAGTACACCTGGCGGTCCGAGCCCGAAGCCCTGAGTGCCTGGATCTGCTGGTG
GACAGTGGGGCTGAAGTGGAGGCCACAGAGCGGCAGGGGGGACGAACAGCCTTGCATCTA
GCCACAGAGATGGAGGAGCTGGGGTTGGTCACCCATCTGGTCACCAAGCTCCGGGCCAAC
GTGAACGCTCGCACCTTTGCGGGAAACACACCCCTGCACCTGGCAGCTGGACTGGGGTAC
CCGACCCTCACCCGCCTCCTTCTGAAGGCTGGTGCTGACATCCATGCTGAAAACGAGGAG
CCCCTGTGCCCACTGCCTTCACCCCCTACCTCTGATAGCGACTCGGACTCTGAAGGGCCT
GAGAAGGACACCCGAAGCAGCTTCCGGGGCCACACGCCTCTTGACCTCACTTGCAGCACC
AAGGTGAAGACCTTGCTGCTAAATGCTGCTCAGAACACCATGGAGCCACCCCTGACCCCG
CCCAGCCCAGCAGGGCCGGGACTGTCACTTGGTGATACAGCTCTGCAGAACCTGGAGCAG
CTGCTAGACGGGCCAGAAGCCCAGGGCAGCTGGGCAGAGCTGGCAGAGCGTCTGGGGCTG
CGCAGCCTGGTAGACACGTACCGACAGACAACCTCACCCAGTGGCAGCCTCCTGCGCAGC
TACGAGCTGGCTGGCGGGGACCTGGCAGGTCTACTGGAGGCCCTGTCTGACATGGGCCTA
GAGGAGGGAGTGAGGCTGCTGAGGGGTCCAGAAACCCGAGACAAGCTGCCCAGCACAGCA
GAGGTGAAGGAAGACAGTGCGTACGGGAGCCAGTCAGTGGAGCAGGAGGCAGAGAAGCTG
GGCCCACCCCCTGAGCCACCAGGAGGGCTCTGCCACGGGCACCCCCAGCCTCAGGTGCAC
TGA
Chromosome Location
10
Locus
10q24
External Identifiers
ResourceLink
UniProtKB IDQ00653
UniProtKB Entry NameNFKB2_HUMAN
GenBank Gene IDX61498
GenAtlas IDNFKB2
HGNC IDHGNC:7795
General References
  1. Schmid RM, Perkins ND, Duckett CS, Andrews PC, Nabel GJ: Cloning of an NF-kappa B subunit which stimulates HIV transcription in synergy with p65. Nature. 1991 Aug 22;352(6337):733-6. [PubMed:1876189]
  2. Bours V, Burd PR, Brown K, Villalobos J, Park S, Ryseck RP, Bravo R, Kelly K, Siebenlist U: A novel mitogen-inducible gene product related to p50/p105-NF-kappa B participates in transactivation through a kappa B site. Mol Cell Biol. 1992 Feb;12(2):685-95. [PubMed:1531086]
  3. Thakur S, Lin HC, Tseng WT, Kumar S, Bravo R, Foss F, Gelinas C, Rabson AB: Rearrangement and altered expression of the NFKB-2 gene in human cutaneous T-lymphoma cells. Oncogene. 1994 Aug;9(8):2335-44. [PubMed:8036016]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Liptay S, Schmid RM, Nabel EG, Nabel GJ: Transcriptional regulation of NF-kappa B2: evidence for kappa B-mediated positive and negative autoregulation. Mol Cell Biol. 1994 Dec;14(12):7695-703. [PubMed:7969113]
  8. Potter DA, Larson CJ, Eckes P, Schmid RM, Nabel GJ, Verdine GL, Sharp PA: Purification of the major histocompatibility complex class I transcription factor H2TF1. The full-length product of the nfkb2 gene. J Biol Chem. 1993 Sep 5;268(25):18882-90. [PubMed:8360178]
  9. Bours V, Franzoso G, Azarenko V, Park S, Kanno T, Brown K, Siebenlist U: The oncoprotein Bcl-3 directly transactivates through kappa B motifs via association with DNA-binding p50B homodimers. Cell. 1993 Mar 12;72(5):729-39. [PubMed:8453667]
  10. Dobrzanski P, Ryseck RP, Bravo R: Differential interactions of Rel-NF-kappa B complexes with I kappa B alpha determine pools of constitutive and inducible NF-kappa B activity. EMBO J. 1994 Oct 3;13(19):4608-16. [PubMed:7925301]
  11. Beg AA, Baldwin AS Jr: Activation of multiple NF-kappa B/Rel DNA-binding complexes by tumor necrosis factor. Oncogene. 1994 May;9(5):1487-92. [PubMed:8152812]
  12. Li Z, Nabel GJ: A new member of the I kappaB protein family, I kappaB epsilon, inhibits RelA (p65)-mediated NF-kappaB transcription. Mol Cell Biol. 1997 Oct;17(10):6184-90. [PubMed:9315679]
  13. Heusch M, Lin L, Geleziunas R, Greene WC: The generation of nfkb2 p52: mechanism and efficiency. Oncogene. 1999 Nov 4;18(46):6201-8. [PubMed:10597218]
  14. Betts JC, Nabel GJ: Differential regulation of NF-kappaB2(p100) processing and control by amino-terminal sequences. Mol Cell Biol. 1996 Nov;16(11):6363-71. [PubMed:8887665]
  15. Xiao G, Harhaj EW, Sun SC: NF-kappaB-inducing kinase regulates the processing of NF-kappaB2 p100. Mol Cell. 2001 Feb;7(2):401-9. [PubMed:11239468]
  16. Neri A, Chang CC, Lombardi L, Salina M, Corradini P, Maiolo AT, Chaganti RS, Dalla-Favera R: B cell lymphoma-associated chromosomal translocation involves candidate oncogene lyt-10, homologous to NF-kappa B p50. Cell. 1991 Dec 20;67(6):1075-87. [PubMed:1760839]
  17. Migliazza A, Lombardi L, Rocchi M, Trecca D, Chang CC, Antonacci R, Fracchiolla NS, Ciana P, Maiolo AT, Neri A: Heterogeneous chromosomal aberrations generate 3' truncations of the NFKB2/lyt-10 gene in lymphoid malignancies. Blood. 1994 Dec 1;84(11):3850-60. [PubMed:7949142]
  18. Lombardi L, Ciana P, Cappellini C, Trecca D, Guerrini L, Migliazza A, Maiolo AT, Neri A: Structural and functional characterization of the promoter regions of the NFKB2 gene. Nucleic Acids Res. 1995 Jun 25;23(12):2328-36. [PubMed:7541912]
  19. Heppner C, Bilimoria KY, Agarwal SK, Kester M, Whitty LJ, Guru SC, Chandrasekharappa SC, Collins FS, Spiegel AM, Marx SJ, Burns AL: The tumor suppressor protein menin interacts with NF-kappaB proteins and inhibits NF-kappaB-mediated transactivation. Oncogene. 2001 Aug 16;20(36):4917-25. [PubMed:11526476]
  20. Amir RE, Haecker H, Karin M, Ciechanover A: Mechanism of processing of the NF-kappa B2 p100 precursor: identification of the specific polyubiquitin chain-anchoring lysine residue and analysis of the role of NEDD8-modification on the SCF(beta-TrCP) ubiquitin ligase. Oncogene. 2004 Apr 1;23(14):2540-7. [PubMed:14676825]
  21. Song YJ, Jen KY, Soni V, Kieff E, Cahir-McFarland E: IL-1 receptor-associated kinase 1 is critical for latent membrane protein 1-induced p65/RelA serine 536 phosphorylation and NF-kappaB activation. Proc Natl Acad Sci U S A. 2006 Feb 21;103(8):2689-94. Epub 2006 Feb 13. [PubMed:16477006]
  22. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  23. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  24. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  25. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  26. Cramer P, Larson CJ, Verdine GL, Muller CW: Structure of the human NF-kappaB p52 homodimer-DNA complex at 2.1 A resolution. EMBO J. 1997 Dec 1;16(23):7078-90. [PubMed:9384586]
  27. Chen K, Coonrod EM, Kumanovics A, Franks ZF, Durtschi JD, Margraf RL, Wu W, Heikal NM, Augustine NH, Ridge PG, Hill HR, Jorde LB, Weyrich AS, Zimmerman GA, Gundlapalli AV, Bohnsack JF, Voelkerding KV: Germline mutations in NFKB2 implicate the noncanonical NF-kappaB pathway in the pathogenesis of common variable immunodeficiency. Am J Hum Genet. 2013 Nov 7;93(5):812-24. doi: 10.1016/j.ajhg.2013.09.009. Epub 2013 Oct 17. [PubMed:24140114]
  28. Brue T, Quentien MH, Khetchoumian K, Bensa M, Capo-Chichi JM, Delemer B, Balsalobre A, Nassif C, Papadimitriou DT, Pagnier A, Hasselmann C, Patry L, Schwartzentruber J, Souchon PF, Takayasu S, Enjalbert A, Van Vliet G, Majewski J, Drouin J, Samuels ME: Mutations in NFKB2 and potential genetic heterogeneity in patients with DAVID syndrome, having variable endocrine and immune deficiencies. BMC Med Genet. 2014 Dec 19;15:139. doi: 10.1186/s12881-014-0139-9. [PubMed:25524009]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05212HE3286investigationalunknownDetails
DB05451P54investigationalunknownDetails
DB05464NOX-700investigationalunknownDetails
DB05471SGN-30investigationalunknownDetails
DB05767AndrographolideinvestigationalunknownDetails
DB05487CustirseninvestigationalunknownDetails
DB01296Glucosamineapproved, investigationalunknownantagonistDetails
DB13961Fish oilapproved, nutraceuticalunknownregulatorDetails
DB13751Glycyrrhizic acidapproved, experimentalyestranslocation inhibitorDetails
DB05559NF-kappaB DecoyinvestigationalunknowninhibitorDetails
DB14059SC-236experimental, investigationalyesinhibitorDetails