Dimethylaniline monooxygenase [N-oxide-forming] 1

Details

Name
Dimethylaniline monooxygenase [N-oxide-forming] 1
Synonyms
  • 1.14.13.8
  • Dimethylaniline oxidase 1
  • Fetal hepatic flavin-containing monooxygenase 1
  • FMO 1
Gene Name
FMO1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006944|Dimethylaniline monooxygenase [N-oxide-forming] 1
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSA
VSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPD
IFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQ
NMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR
PSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGK
WEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
Number of residues
532
Molecular Weight
60310.285
Theoretical pI
7.22
GO Classification
Functions
flavin adenine dinucleotide binding / monooxygenase activity / N,N-dimethylaniline monooxygenase activity / NADP binding
Processes
drug metabolic process / NADPH oxidation / organic acid metabolic process / response to lipopolysaccharide / response to osmotic stress / small molecule metabolic process / toxin metabolic process / xenobiotic metabolic process
Components
endoplasmic reticulum lumen / endoplasmic reticulum membrane / integral component of membrane
General Function
Nadp binding
Specific Function
This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Microsome membrane
Gene sequence
>lcl|BSEQ0019446|Dimethylaniline monooxygenase [N-oxide-forming] 1 (FMO1)
ATGCAGGAGAACATGGCCAAGCGAGTTGCCATTGTGGGAGCTGGGGTCAGCGGCCTGGCC
TCCATCAAGTGCTGTCTGGAAGAAGGACTGGAGCCCACCTGCTTTGAGAGGAGCGATGAC
CTTGGGGGGCTGTGGAGATTCACCGAACATGTTGAAGAAGGCAGAGCCAGTCTCTACAAG
TCTGTGGTTTCCAACAGCTGCAAGGAGATGTCTTGTTACTCAGACTTTCCATTCCCAGAA
GATTATCCAAACTATGTGCCAAATTCTCAATTCCTGGAATATCTCAAAATGTATGCAAAC
CACTTTGACCTTCTGAAACACATTCAATTCAAGACCAAAGTCTGCAGTGTAACAAAATGC
TCAGATTCTGCTGTCTCTGGCCAATGGGAGGTGGTCACTATGCATGAAGAGAAGCAAGAG
TCAGCCATCTTTGATGCTGTCATGGTCTGCACTGGCTTTCTTACTAATCCTTATTTGCCA
CTGGATTCCTTTCCAGGTATTAATGCCTTTAAAGGCCAGTACTTTCATAGCCGGCAATAT
AAGCATCCAGATATATTTAAGGACAAGAGAGTCCTTGTGATTGGAATGGGAAATTCTGGC
ACAGACATTGCTGTGGAGGCCAGCCACCTGGCGGAAAAGGTGTTCCTCAGCACCACCGGA
GGGGGATGGGTGATCAGCCGAATCTTTGACTCGGGCTACCCATGGGACATGGTGTTCATG
ACACGCTTTCAGAACATGTTGAGAAATTCCCTCCCAACCCCAATTGTGACTTGGTTGATG
GAGCGAAAGATAAACAACTGGCTCAATCATGCAAATTACGGCTTAATACCAGAAGACAGG
ACTCAGCTGAAAGAGTTTGTGCTAAATGATGAGCTCCCAGGACGCATCATCACTGGGAAA
GTGTTCATCAGGCCAAGCATAAAAGAGGTAAAGGAAAACTCTGTCATATTTAACAATACT
TCAAAGGAAGAGCCTATTGACATCATTGTCTTTGCCACTGGATACACATTTGCTTTCCCC
TTCCTTGATGAGTCTGTAGTGAAAGTTGAAGATGGCCAGGCCTCACTGTACAAGTATATC
TTCCCTGCACATCTGCAAAAGCCAACCCTGGCCATTATTGGCCTCATCAAACCCTTGGGC
TCCATGATACCTACAGGAGAAACACAAGCTCGGTGGGCTGTTCGAGTCCTGAAAGGTGTA
AATAAGTTACCACCACCAAGTGTCATGATAGAGGAAATTAATGCAAGGAAAGAAAACAAG
CCCAGTTGGTTTGGCTTGTGCTACTGCAAGGCTTTACAATCAGATTATATCACATACATA
GATGAACTCCTGACCTATATCAATGCAAAACCCAACCTGTTCTCTATGCTCCTAACGGAT
CCACATCTGGCTCTGACCGTCTTCTTTGGCCCATGCTCACCATACCAGTTCCGCTTGACT
GGCCCAGGAAAATGGGAAGGAGCCAGAAATGCCATCATGACCCAGTGGGACCGAACATTC
AAGGTCATCAAAGCTCGAGTTGTACAAGAGTCTCCATCTCCCTTTGAAAGTTTTCTTAAA
GTCTTTAGCTTTCTGGCTTTGCTTGTGGCTATTTTTCTGATTTTCCTATAA
Chromosome Location
1
Locus
1q23-q25
External Identifiers
ResourceLink
UniProtKB IDQ01740
UniProtKB Entry NameFMO1_HUMAN
GenBank Protein ID182671
GenBank Gene IDM64082
HGNC IDHGNC:3769
General References
  1. Dolphin C, Shephard EA, Povey S, Palmer CN, Ziegler DM, Ayesh R, Smith RL, Phillips IR: Cloning, primary sequence, and chromosomal mapping of a human flavin-containing monooxygenase (FMO1). J Biol Chem. 1991 Jul 5;266(19):12379-85. [PubMed:1712018]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Furnes B, Feng J, Sommer SS, Schlenk D: Identification of novel variants of the flavin-containing monooxygenase gene family in African Americans. Drug Metab Dispos. 2003 Feb;31(2):187-93. [PubMed:12527699]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00675TamoxifenapprovedunknownsubstrateDetails
DB00582VoriconazoleapprovedunknownsubstrateDetails
DB00185CevimelineapprovedunknownsubstrateDetails
DB00501Cimetidineapproved, investigationalunknownsubstrateDetails
DB04871LorcaserinapprovednosubstrateDetails
DB05294VandetanibapprovedunknownsubstrateDetails
DB12278Propiverineapproved, investigationalunknownsubstrateDetails
DB00768OlopatadineapprovednosubstrateDetails