C protein alpha-antigen

Details

Name
C protein alpha-antigen
Synonyms
  • C protein alpha-antigen precursor
Gene Name
bca
Organism
Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Amino acid sequence
>lcl|BSEQ0017062|C protein alpha-antigen
MFRRSKNNSYDTSQTKQRFSIKKFKFGAASVLIGLSFLGGVTQGNLNIFEESIVAASTIP
GSAATLNTSITKNIQNGNAYIDLYDVKLGKIDPLQLIVLEQGFTAKYVFRQGTKYYGDVS
QLQSTGRASLTYNIFGEDGLPHVKTDGQIDIVSVALTIYDSTTLRDKIEEVRTNANDPKW
TEESRTEVLTGLDTIKTDIDNNPKTQTDIDSKIVEVNELEKLLVLSVPDKDKYDPTGGET
TVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEV
TVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNV
PGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDL
VKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYD
PTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGT
KDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGD
RPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSD
KEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVP
DKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEV
TYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQGTPVSDKEITDLVKIPDGSKGV
PTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHVTPKPVPDKDKYDPTGGETTVPQ
GTPVSDKEITDLVKIPDGSKGVPTVVGDRPDTNVPGDHKVTVEVTYPDGTKDTVEVTVHV
TPKPVPDKDKYDPTGKAQQVNGKGNKLPATGENATPFFNVAALTIISSVGLLSVSKKKED
Number of residues
1020
Molecular Weight
108704.715
Theoretical pI
4.53
GO Classification
Processes
pathogenesis
Components
cell wall / extracellular region / membrane
General Function
Not Available
Specific Function
May play a role in both virulence and immunity.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0017063|C protein alpha-antigen (bca)
ATGTTTAGAAGGTCTAAAAATAACAGTTATGATACTTCACAGACGAAACAACGGTTTTCA
ATTAAGAAGTTCAAGTTTGGTGCAGCTTCTGTACTAATTGGTCTTAGTTTTTTGGGTGGG
GTTACACAAGGTAATCTTAATATTTTTGAAGAGTCAATAGTTGCTGCATCTACAATTCCA
GGGAGTGCAGCGACCTTAAATACAAGCATCACTAAAAATATACAAAACGGAAATGCTTAC
ATAGATTTATATGATGTAAAATTAGGTAAAATAGATCCATTACAATTAATTGTTTTAGAA
CAAGGTTTTACAGCAAAGTATGTTTTTAGACAAGGTACTAAATACTATGGGGATGTTTCT
CAGTTGCAGAGTACAGGAAGGGCTAGTCTTACCTATAATATATTTGGTGAAGATGGACTA
CCACATGTAAAGACTGATGGACAAATTGATATAGTTAGTGTTGCTTTAACTATTTATGAT
TCAACAACCTTGAGGGATAAGATTGAAGAAGTTAGAACGAATGCAAACGATCCTAAGTGG
ACGGAAGAAAGTCGTACTGAGGTTTTAACAGGATTAGATACAATTAAGACAGATATTGAT
AATAATCCTAAGACGCAAACAGATATTGATAGTAAAATTGTTGAGGTTAATGAATTAGAG
AAATTGTTAGTATTGTCAGTACCGGATAAAGATAAATATGATCCAACAGGAGGGGAAACA
ACAGTACCCCAAGGGACACCAGTTTCAGATAAAGAAATCACAGACTTAGTTAAGATTCCA
GATGGCTCAAAAGGGGTTCCGACAGTTGTTGGTGATCGTCCAGATACTAACGTTCCTGGA
GATCATAAAGTAACGGTAGAAGTAACGTATCCAGATGGAACAAAGGATACAGTAGAAGTA
ACGGTTCATGTGACACCAAAACCAGTACCGGATAAAGATAAATATGATCCAACAGGAGGG
GAAACAACAGTACCCCAAGGGACACCAGTTTCAGATAAAGAAATCACAGACTTAGTTAAG
ATTCCAGATGGCTCAAAAGGGGTTCCGACAGTTGTTGGTGATCGTCCAGATACTAACGTT
CCTGGAGATCATAAAGTAACGGTAGAAGTAACGTATCCAGATGGAACAAAGGATACAGTA
GAAGTAACGGTTCATGTGACACCAAAACCAGTACCGGATAAAGATAAATATGATCCAACA
GGAGGGGAAACAACAGTACCCCAAGGGACACCAGTTTCAGATAAAGAAATCACAGACTTA
GTTAAGATTCCAGATGGCTCAAAAGGGGTTCCGACAGTTGTTGGTGATCGTCCAGATACT
AACGTTCCTGGAGATCATAAAGTAACGGTAGAAGTAACGTATCCAGATGGAACAAAGGAT
ACAGTAGAAGTAACGGTTCATGTGACACCAAAACCAGTACCGGATAAAGATAAATATGAT
CCAACAGGAGGGGAAACAACAGTACCCCAAGGGACACCAGTTTCAGATAAAGAAATCACA
GACTTAGTTAAGATTCCAGATGGCTCAAAAGGGGTTCCGACAGTTGTTGGTGATCGTCCA
GATACTAACGTTCCTGGAGATCATAAAGTAACGGTAGAAGTAACGTATCCAGATGGAACA
AAGGATACAGTAGAAGTAACGGTTCATGTGACACCAAAACCAGTACCGGATAAAGATAAA
TATGATCCAACAGGAGGGGAAACAACAGTACCCCAAGGGACACCAGTTTCAGATAAAGAA
ATCACAGACTTAGTTAAGATTCCAGATGGCTCAAAAGGGGTTCCGACAGTTGTTGGTGAT
CGTCCAGATACTAACGTTCCTGGAGATCATAAAGTAACGGTAGAAGTAACGTATCCAGAT
GGAACAAAGGATACAGTAGAAGTAACGGTTCATGTGACACCAAAACCAGTACCGGATAAA
GATAAATATGATCCAACAGGAGGGGAAACAACAGTACCCCAAGGGACACCAGTTTCAGAT
AAAGAAATCACAGACTTAGTTAAGATTCCAGATGGCTCAAAAGGGGTTCCGACAGTTGTT
GGTGATCGTCCAGATACTAACGTTCCTGGAGATCATAAAGTAACGGTAGAAGTAACGTAT
CCAGATGGAACAAAGGATACAGTAGAAGTAACGGTTCATGTGACACCAAAACCAGTACCG
GATAAAGATAAATATGATCCAACAGGAGGGGAAACAACAGTACCCCAAGGGACACCAGTT
TCAGATAAAGAAATCACAGACTTAGTTAAGATTCCAGATGGCTCAAAAGGGGTTCCGACA
GTTGTTGGTGATCGTCCAGATACTAACGTTCCTGGAGATCATAAAGTAACGGTAGAAGTA
ACGTATCCAGATGGAACAAAGGATACAGTAGAAGTAACGGTTCATGTGACACCAAAACCA
GTACCGGATAAAGATAAATATGATCCAACAGGAGGGGAAACAACAGTACCCCAAGGGACA
CCAGTTTCAGATAAAGAAATCACAGACTTAGTTAAGATTCCAGATGGCTCAAAAGGGGTT
CCGACAGTTGTTGGTGATCGTCCAGATACTAACGTTCCTGGAGATCATAAAGTAACGGTA
GAAGTAACGTATCCAGATGGAACAAAGGATACAGTAGAAGTAACGGTTCATGTGACACCA
AAACCAGTACCGGATAAAGATAAATATGATCCAACAGGAGGGGAAACAACAGTACCCCAA
GGGACACCAGTTTCAGATAAAGAAATCACAGACTTAGTTAAGATTCCAGATGGCTCAAAA
GGGGTTCCGACAGTTGTTGGTGATCGTCCAGATACTAACGTTCCTGGAGATCATAAAGTA
ACGGTAGAAGTAACGTATCCAGATGGAACAAAGGATACAGTAGAAGTAACGGTTCATGTG
ACACCAAAACCAGTACCGGATAAAGATAAATATGATCCAACAGGTAAAGCTCAGCAAGTC
AACGGTAAAGGAAATAAACTACCAGCAACAGGTGAGAATGCAACTCCATTCTTTAATGTT
GCAGCTTTGACAATTATATCATCAGTTGGTTTATTATCTGTTTCTAAGAAAAAAGAGGAT
TAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ02192
UniProtKB Entry NameBCA_STRA1
GenBank Gene IDM97256
General References
  1. Michel JL, Madoff LC, Olson K, Kling DE, Kasper DL, Ausubel FM: Large, identical, tandem repeating units in the C protein alpha antigen gene, bca, of group B streptococci. Proc Natl Acad Sci U S A. 1992 Nov 1;89(21):10060-4. [PubMed:1438195]
  2. Tettelin H, Masignani V, Cieslewicz MJ, Donati C, Medini D, Ward NL, Angiuoli SV, Crabtree J, Jones AL, Durkin AS, Deboy RT, Davidsen TM, Mora M, Scarselli M, Margarit y Ros I, Peterson JD, Hauser CR, Sundaram JP, Nelson WC, Madupu R, Brinkac LM, Dodson RJ, Rosovitz MJ, Sullivan SA, Daugherty SC, Haft DH, Selengut J, Gwinn ML, Zhou L, Zafar N, Khouri H, Radune D, Dimitrov G, Watkins K, O'Connor KJ, Smith S, Utterback TR, White O, Rubens CE, Grandi G, Madoff LC, Kasper DL, Telford JL, Wessels MR, Rappuoli R, Fraser CM: Genome analysis of multiple pathogenic isolates of Streptococcus agalactiae: implications for the microbial "pan-genome". Proc Natl Acad Sci U S A. 2005 Sep 27;102(39):13950-5. Epub 2005 Sep 19. [PubMed:16172379]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB044471,4-DithiothreitolexperimentalunknownDetails