Inter-alpha-trypsin inhibitor heavy chain H3

Details

Name
Inter-alpha-trypsin inhibitor heavy chain H3
Synonyms
  • ITI heavy chain H3
  • Serum-derived hyaluronan-associated protein
  • SHAP
Gene Name
ITIH3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049872|Inter-alpha-trypsin inhibitor heavy chain H3
MAFAWWPCLILALLSSLAASGFPRSPFRLLGKRSLPEGVANGIEVYSTKINSKVTSRFAH
NVVTMRAVNRADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVS
QGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVK
HFEIEVDIFEPQGISMLDAEASFITNDLLGSALTKSFSGKKGHVSFKPSLDQQRSCPTCT
DSLLNGDFTITYDVNRESPGNVQIVNGYFVHFFAPQGLPVVPKNVAFVIDISGSMAGRKL
EQTKEALLRILEDMQEEDYLNFILFSGDVSTWKEHLVQATPENLQEARTFVKSMEDKGMT
NINDGLLRGISMLNKAREEHRIPERSTSIVIMLTDGDANVGESRPEKIQENVRNAIGGKF
PLYNLGFGNNLNYNFLENMALENHGFARRIYEDSDADLQLQGFYEEVANPLLTGVEMEYP
ENAILDLTQNTYQHFYDGSEIVVAGRLVDEDMNSFKADVKGHGATNDLTFTEEVDMKEME
KALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTS
MVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGDPHFIIQIPE
KDDALCFNIDEAPGTVLRLIQDAVTGLTVNGQITGDKRGSPDSKTRKTYFGKLGIANAQM
DFQVEVTTEKITLWNRAVPSTFSWLDTVTVTQDGLSMMINRKNMVVSFGDGVTFVVVLHQ
VWKKHPVHRDFLGFYVVDSHRMSAQTHGLLGQFFQPFDFKVSDIRPGSDPTKPDATLVVK
NHQLIVTRGSQKDYRKDASIGTKVVCWFVHNNGEGLIDGVHTDYIVPNLF
Number of residues
890
Molecular Weight
99848.575
Theoretical pI
Not Available
GO Classification
Functions
endopeptidase inhibitor activity / serine-type endopeptidase inhibitor activity
Processes
hyaluronan metabolic process / platelet degranulation
Components
extracellular exosome / extracellular region / platelet dense granule lumen
General Function
May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
Specific Function
Endopeptidase inhibitor activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049873|Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3)
ATGGCATTTGCATGGTGGCCCTGTCTCATCTTGGCTCTGCTCTCCAGCTTGGCAGCCTCT
GGCTTCCCGAGAAGCCCCTTTCGGCTGCTTGGGAAACGGAGCCTCCCGGAAGGGGTGGCC
AATGGCATCGAGGTCTACAGTACCAAAATCAACTCCAAGGTGACCTCCCGTTTTGCTCAC
AATGTTGTCACCATGAGAGCCGTCAACCGTGCAGACACGGCCAAGGAGGTTTCCTTTGAT
GTGGAGCTGCCCAAGACGGCCTTCATCACCAACTTCACCTTGACCATCGACGGTGTTACC
TACCCTGGGAATGTCAAGGAGAAGGAAGTTGCCAAGAAGCAGTATGAAAAGGCTGTGTCC
CAGGGCAAGACGGCCGGCTTGGTCAAGGCCTCTGGGAGGAAGTTGGAGAAGTTCACAGTC
TCGGTCAACGTGGCTGCAGGCAGCAAAGTCACCTTCGAGCTAACCTACGAGGAGCTGCTG
AAGAGGCACAAGGGCAAGTACGAGATGTACCTCAAGGTCCAGCCTAAGCAACTGGTCAAA
CACTTTGAGATCGAGGTAGACATCTTCGAGCCTCAGGGAATCAGCATGCTGGATGCTGAG
GCCTCTTTCATCACCAACGACCTCCTGGGAAGCGCCCTCACCAAGTCCTTCTCAGGGAAA
AAGGGCCATGTGTCCTTCAAGCCCAGCTTAGACCAACAGCGTTCATGCCCAACCTGTACA
GACTCCCTCCTCAATGGAGATTTCACTATCACCTATGACGTGAACAGAGAATCTCCTGGC
AACGTGCAGATAGTCAATGGCTACTTCGTGCACTTCTTTGCACCTCAAGGCCTTCCAGTG
GTGCCTAAGAACGTGGCCTTTGTGATTGACATCAGCGGCTCCATGGCTGGTCGGAAATTA
GAGCAGACAAAGGAGGCCCTTCTCAGAATCCTGGAAGATATGCAAGAGGAAGACTATCTG
AATTTCATCCTGTTCAGTGGAGATGTGTCCACATGGAAAGAGCACTTAGTCCAGGCCACG
CCCGAGAACCTCCAGGAGGCCAGGACGTTTGTGAAGAGCATGGAGGATAAAGGAATGACC
AACATCAATGACGGGCTGCTGAGGGGCATCAGTATGCTGAACAAGGCCCGAGAGGAGCAC
AGAATCCCAGAGAGGAGCACCTCCATTGTCATCATGCTGACTGATGGGGATGCCAATGTT
GGTGAGAGCAGACCCGAAAAAATCCAAGAGAATGTGCGGAATGCCATCGGGGGCAAGTTC
CCCTTGTATAACCTGGGCTTTGGCAACAATCTGAATTATAACTTCCTGGAGAACATGGCC
CTGGAGAACCATGGGTTTGCCCGGCGCATTTATGAGGACTCTGATGCCGATTTGCAGTTG
CAGGGCTTCTATGAGGAGGTGGCCAACCCACTGCTGACGGGTGTGGAGATGGAGTACCCC
GAGAACGCTATCCTGGACCTCACCCAGAACACTTACCAGCACTTCTACGATGGCTCTGAG
ATCGTGGTGGCCGGGCGCCTGGTGGACGAGGACATGAACAGCTTTAAGGCAGATGTGAAG
GGCCATGGGGCCACCAACGACCTGACCTTCACAGAGGAGGTGGACATGAAGGAGATGGAG
AAGGCCCTGCAGGAGCGGGACTACATCTTCGGGAATTACATTGAGCGGCTCTGGGCCTAC
CTCACCATTGAGCAGCTGCTGGAGAAGCGCAAGAACGCCCATGGCGAGGAGAAGGAGAAC
CTCACGGCCCGGGCCCTGGACCTGTCCCTCAAGTATCACTTTGTGACTCCACTGACCTCA
ATGGTGGTGACCAAGCCTGAGGACAACGAGGATGAGAGGGCCATTGCCGACAAGCCTGGG
GAAGATGCAGAAGCCACACCGGTGAGCCCCGCCATGTCCTACCTGACCAGCTACCAGCCT
CCTCAAAACCCCTACTACTATGTGGACGGGGATCCCCACTTCATCATCCAAATTCCGGAG
AAAGACGATGCCCTCTGCTTCAACATCGATGAAGCCCCAGGCACAGTGCTGCGCCTTATT
CAGGATGCAGTCACAGGCCTCACAGTTAATGGGCAGATCACTGGCGACAAGAGAGGCAGC
CCTGACTCCAAGACCAGAAAGACTTACTTTGGAAAACTGGGCATCGCCAATGCTCAGATG
GACTTCCAGGTGGAGGTGACAACGGAGAAGATCACCCTGTGGAACAGGGCCGTGCCGAGC
ACTTTCAGCTGGCTGGACACAGTCACAGTCACGCAGGATGGGCTGTCCATGATGATCAAC
AGGAAGAACATGGTGGTCTCCTTTGGAGATGGGGTTACCTTCGTGGTCGTCCTACACCAG
GTGTGGAAGAAACATCCTGTCCACCGTGACTTTCTAGGCTTCTACGTGGTGGACAGTCAC
CGGATGTCAGCACAGACGCATGGGCTGCTGGGGCAATTCTTCCAACCCTTTGACTTTAAA
GTGTCTGACATCCGGCCAGGCTCTGACCCCACAAAGCCAGATGCCACATTGGTGGTGAAG
AACCATCAGCTGATTGTCACCAGGGGCTCCCAGAAAGACTACAGAAAGGATGCCAGCATC
GGCACGAAGGTTGTCTGCTGGTTCGTCCACAACAACGGAGAAGGGCTGATTGATGGTGTC
CACACTGACTACATTGTCCCCAACCTGTTTTGA
Chromosome Location
3
Locus
3p21.1
External Identifiers
ResourceLink
UniProtKB IDQ06033
UniProtKB Entry NameITIH3_HUMAN
HGNC IDHGNC:6168
General References
  1. Bourguignon J, Diarra-Mehrpour M, Thiberville L, Bost F, Sesboue R, Martin JP: Human pre-alpha-trypsin inhibitor-precursor heavy chain. cDNA and deduced amino-acid sequence. Eur J Biochem. 1993 Mar 15;212(3):771-6. [PubMed:7681778]
  2. Diarra-Mehrpour M, Sarafan N, Bourguignon J, Bonnet F, Bost F, Martin JP: Human inter-alpha-trypsin inhibitor heavy chain H3 gene. Genomic organization, promoter analysis, and gene linkage. J Biol Chem. 1998 Oct 9;273(41):26809-19. [PubMed:9756925]
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Diarra-Mehrpour M, Bourguignon J, Sarafan N, Bost F, Sesboue R, Muschio-Bonnet F, Martin JP: Tandem orientation of the inter-alpha-trypsin inhibitor heavy chain H1 and H3 genes. Biochim Biophys Acta. 1994 Oct 18;1219(2):551-4. [PubMed:7522574]
  6. Enghild JJ, Thogersen IB, Pizzo SV, Salvesen G: Analysis of inter-alpha-trypsin inhibitor and a novel trypsin inhibitor, pre-alpha-trypsin inhibitor, from human plasma. Polypeptide chain stoichiometry and assembly by glycan. J Biol Chem. 1989 Sep 25;264(27):15975-81. [PubMed:2476436]
  7. Diarra-Mehrpour M, Bourguignon J, Sesboue R, Mattei MG, Passage E, Salier JP, Martin JP: Human plasma inter-alpha-trypsin inhibitor is encoded by four genes on three chromosomes. Eur J Biochem. 1989 Jan 15;179(1):147-54. [PubMed:2465147]
  8. Enghild JJ, Salvesen G, Hefta SA, Thogersen IB, Rutherfurd S, Pizzo SV: Chondroitin 4-sulfate covalently cross-links the chains of the human blood protein pre-alpha-inhibitor. J Biol Chem. 1991 Jan 15;266(2):747-51. [PubMed:1898736]
  9. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails