Amyloid-like protein 2

Details

Name
Amyloid-like protein 2
Synonyms
  • Amyloid protein homolog
  • APLP-2
  • APPH
  • APPL2
  • CDEBP
  • CDEI box-binding protein
Gene Name
APLP2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049895|Amyloid-like protein 2
MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLN
MHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDK
KQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMT
LYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEF
PTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDK
EITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC
KAMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAK
NLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQ
SDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERR
NQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFH
PFHPFPALPENEDTQPELYHPMKKGSGVGEQDGGLIGAEEKVINSKNKVDENMVIDETLD
VKEMIFNAERVGGLEEERESVGPLREDFSLSSSALIGLLVIAVAIATVIVISLVMLRKRQ
YGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI
Number of residues
763
Molecular Weight
86955.2
Theoretical pI
Not Available
GO Classification
Functions
DNA binding / heparin binding / identical protein binding / serine-type endopeptidase inhibitor activity / transition metal ion binding
Processes
G-protein coupled receptor signaling pathway / platelet degranulation
Components
extracellular exosome / integral component of membrane / membrane / nucleus / plasma membrane / platelet alpha granule membrane
General Function
May play a role in the regulation of hemostasis. The soluble form may have inhibitory properties towards coagulation factors. May interact with cellular G-protein signaling pathways. May bind to the DNA 5'-GTCACATG-3'(CDEI box). Inhibits trypsin, chymotrypsin, plasmin, factor XIA and plasma and glandular kallikrein. Modulates the Cu/Zn nitric oxide-catalyzed autodegradation of GPC1 heparan sulfate side chains in fibroblasts (By similarity).
Specific Function
Dna binding
Pfam Domain Function
Transmembrane Regions
693-716
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0049896|Amyloid-like protein 2 (APLP2)
ATGGCGGCCACCGGGACCGCGGCCGCCGCAGCCACGGGCAGGCTCCTGCTTCTGCTGCTG
GTGGGGCTCACGGCGCCTGCCTTGGCGCTGGCCGGCTACATCGAGGCTCTTGCAGCCAAT
GCCGGAACAGGATTTGCTGTTGCTGAGCCTCAAATCGCAATGTTTTGTGGGAAGTTAAAT
ATGCATGTGAACATTCAGACTGGGAAATGGGAACCTGATCCAACAGGCACCAAGAGCTGC
TTTGAAACAAAAGAAGAAGTTCTTCAGTACTGTCAGGAGATGTATCCAGAGCTACAGATC
ACAAATGTGATGGAGGCAAACCAGCGGGTTAGTATTGACAACTGGTGCCGGAGGGACAAA
AAGCAATGCAAGAGTCGCTTTGTTACACCTTTCAAGTGTCTCGTGGGTGAATTTGTAAGT
GATGTCCTGCTAGTTCCAGAAAAGTGCCAGTTTTTCCACAAAGAGCGGATGGAGGTGTGT
GAGAATCACCAGCACTGGCACACGGTAGTCAAAGAGGCATGTCTGACTCAGGGAATGACC
TTATATAGCTACGGCATGCTGCTCCCATGTGGGGTAGACCAGTTCCATGGCACTGAATAT
GTGTGCTGCCCTCAGACAAAGATTATTGGATCTGTGTCAAAAGAAGAGGAAGAGGAAGAT
GAAGAGGAAGAGGAAGAGGAAGATGAAGAGGAAGACTATGATGTTTATAAAAGTGAATTT
CCTACTGAAGCAGATCTGGAAGACTTCACAGAAGCAGCTGTGGATGAGGATGATGAGGAT
GAGGAAGAAGGGGAGGAAGTGGTGGAGGACCGAGATTACTACTATGACACCTTCAAAGGA
GATGACTACAATGAGGAGAATCCTACTGAACCCGGCAGCGACGGCACCATGTCAGACAAG
GAAATTACTCATGATGTCAAAGCTGTCTGCTCCCAGGAGGCGATGACGGGGCCCTGCCGG
GCCGTGATGCCTCGTTGGTACTTCGACCTCTCCAAGGGAAAGTGCGTGCGCTTTATATAT
GGTGGCTGCGGCGGCAACAGGAACAATTTTGAGTCTGAGGATTATTGTATGGCTGTGTGT
AAAGCGATGATTCCTCCAACTCCTCTGCCAACCAATGATGTTGATGTGTATTTCGAGACC
TCTGCAGATGATAATGAGCATGCTCGCTTCCAGAAGGCTAAGGAGCAGCTGGAGATTCGG
CACCGCAACCGAATGGACAGGGTAAAGAAGGAATGGGAAGAGGCAGAGCTTCAAGCTAAG
AACCTCCCCAAAGCAGAGAGGCAGACTCTGATTCAGCACTTCCAAGCCATGGTTAAAGCT
TTAGAGAAGGAAGCAGCCAGTGAGAAGCAGCAGCTGGTGGAGACCCACCTGGCCCGAGTG
GAAGCTATGCTGAATGACCGCCGTCGGATGGCTCTGGAGAACTACCTGGCTGCCTTGCAG
TCTGACCCGCCACGGCCTCATCGCATTCTCCAGGCCTTACGGCGTTATGTCCGTGCTGAG
AACAAAGATCGCTTACATACCATCCGTCATTACCAGCATGTGTTGGCTGTTGACCCAGAA
AAGGCGGCCCAGATGAAATCCCAGGTGATGACACATCTCCACGTGATTGAAGAAAGGAGG
AACCAAAGCCTCTCTCTGCTCTACAAAGTACCTTATGTAGCCCAAGAAATTCAAGAGGAA
ATTGATGAGCTCCTTCAGGAGCAGCGTGCAGATATGGACCAGTTCACTGCCTCAATCTCA
GAGACCCCTGTGGACGTCCGGGTGAGCTCTGAGGAGAGTGAGGAGATCCCACCGTTCCAC
CCCTTCCACCCCTTCCCAGCCCTACCTGAGAACGAAGACACTCAGCCGGAGTTGTACCAC
CCAATGAAAAAAGGATCTGGAGTGGGAGAGCAGGATGGGGGACTGATCGGTGCCGAAGAG
AAAGTGATTAACAGTAAGAATAAAGTGGATGAAAACATGGTCATTGACGAGACTCTGGAT
GTTAAGGAAATGATTTTCAATGCCGAGAGAGTTGGAGGCCTCGAGGAAGAGCGGGAATCC
GTGGGCCCACTGCGGGAGGACTTCAGTCTGAGTAGCAGTGCTCTCATTGGCCTGCTGGTC
ATCGCAGTGGCCATTGCCACGGTCATCGTCATCAGCCTGGTGATGCTGAGGAAGAGGCAG
TATGGCACCATCAGCCACGGGATCGTGGAGGTTGATCCAATGCTCACCCCAGAAGAGCGT
CACCTGAACAAGATGCAGAACCATGGCTATGAGAACCCCACCTACAAATACCTGGAGCAG
ATGCAGATTTAG
Chromosome Location
11
Locus
11q24.3
External Identifiers
ResourceLink
UniProtKB IDQ06481
UniProtKB Entry NameAPLP2_HUMAN
HGNC IDHGNC:598
General References
  1. Sprecher CA, Grant FJ, Grimm G, O'Hara PJ, Norris F, Norris K, Foster DC: Molecular cloning of the cDNA for a human amyloid precursor protein homolog: evidence for a multigene family. Biochemistry. 1993 May 4;32(17):4481-6. [PubMed:8485127]
  2. Wasco W, Gurubhagavatula S, Paradis MD, Romano DM, Sisodia SS, Hyman BT, Neve RL, Tanzi RE: Isolation and characterization of APLP2 encoding a homologue of the Alzheimer's associated amyloid beta protein precursor. Nat Genet. 1993 Sep;5(1):95-100. [PubMed:8220435]
  3. von der Kammer H, Hanes J, Klaudiny J, Scheit KH: A human amyloid precursor-like protein is highly homologous to a mouse sequence-specific DNA-binding protein. DNA Cell Biol. 1994 Nov;13(11):1137-43. [PubMed:7702756]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Vostrov AA, Quitschke WW, Vidal F, Schwarzman AL, Goldgaber D: USF binds to the APB alpha sequence in the promoter of the amyloid beta-protein precursor gene. Nucleic Acids Res. 1995 Jul 25;23(14):2734-41. [PubMed:7651835]
  6. Huang P, Miao S, Fan H, Sheng Q, Yan Y, Wang L, Koide SS: Expression and characterization of the human YWK-II gene, encoding a sperm membrane protein related to the alzheimer betaA4-amyloid precursorprotein. Mol Hum Reprod. 2000 Dec;6(12):1069-78. [PubMed:11101689]
  7. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  9. Petersen LC, Bjorn SE, Norris F, Norris K, Sprecher C, Foster DC: Expression, purification and characterization of a Kunitz-type protease inhibitor domain from human amyloid precursor protein homolog. FEBS Lett. 1994 Jan 24;338(1):53-7. [PubMed:8307156]
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  11. Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028. [PubMed:26091039]
  12. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknowncofactorDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails