Carminomycin 4-O-methyltransferase DnrK

Details

Name
Carminomycin 4-O-methyltransferase DnrK
Synonyms
  • 2.1.1.292
  • Anthracycline 4-O-methyltransferase
  • COMT
Gene Name
dnrK
Organism
Streptomyces peucetius
Amino acid sequence
>lcl|BSEQ0021978|Carminomycin 4-O-methyltransferase DnrK
MTAEPTVAARPQQIDALRTLIRLGSLHTPMVVRTAATLRLVDHILAGARTVKALAARTDT
RPEALLRLIRHLVAIGLLEEDAPGEFVPTEVGELLADDHPAAQRAWHDLTQAVARADISF
TRLPDAIRTGRPTYESIYGKPFYEDLAGRPDLRASFDSLLACDQDVAFDAPAAAYDWTNV
RHVLDVGGGKGGFAAAIARRAPHVSATVLEMAGTVDTARSYLKDEGLSDRVDVVEGDFFE
PLPRKADAIILSFVLLNWPDHDAVRILTRCAEALEPGGRILIHERDDLHENSFNEQFTEL
DLRMLVFLGGALRTREKWDGLAASAGLVVEEVRQLPSPTIPYDLSLLVLAPAATGA
Number of residues
356
Molecular Weight
38781.615
Theoretical pI
4.95
GO Classification
Functions
methyltransferase activity / O-methyltransferase activity
Processes
daunorubicin biosynthetic process
General Function
Not Available
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0003394|1071 bp
ATGACAGCCGAACCGACGGTCGCGGCCCGGCCGCAGCAGATCGACGCCCTCAGGACCCTG
ATCCGCCTCGGAAGCCTGCACACGCCCATGGTCGTCCGGACGGCCGCCACCCTGCGGCTC
GTCGACCACATCCTGGCCGGGGCCCGCACCGTGAAGGCCCTGGCGGCCAGGACAGACACC
CGGCCGGAAGCACTCCTGCGACTGATCCGCCACCTGGTGGCGATCGGACTGCTCGAGGAG
GACGCACCGGGCGAGTTCGTCCCGACCGAGGTCGGCGAGCTGCTCGCCGACGACCACCCA
GCCGCGCAGCGTGCCTGGCACGACCTGACGCAGGCCGTGGCGCGCGCCGACATCTCCTTC
ACCCGCCTCCCCGACGCCATCCGTACCGGCCGCCCCACGTACGAGTCCATCTACGGCAAG
CCGTTCTACGAGGACCTGGCCGGCCGCCCCGACCTGCGCGCGTCCTTCGACTCGCTGCTC
GCCTGCGACCAGGACGTCGCCTTCGACGCTCCGGCCGCCGCGTACGACTGGACGAACGTC
CGGCATGTGCTCGACGTGGGTGGCGGCAAGGGTGGTTTCGCCGCGGCCATCGCGCGCCGG
GCCCCGCACGTGTCGGCCACCGTGCTGGAGATGGCGGGCACCGTGGACACCGCCCGCTCC
TACCTGAAGGACGAGGGCCTCTCCGACCGTGTCGACGTCGTCGAGGGGGACTTCTTCGAG
CCGCTGCCCCGCAAGGCGGACGCGATCATCCTCTCTTTCGTCCTCCTCAACTGGCCGGAC
CACGACGCCGTCCGGATCCTCACCCGCTGCGCCGAGGCCCTGGAGCCCGGCGGGCGCATC
CTGATCCACGAGCGCGACGACCTCCACGAGAACTCGTTCAACGAACAGTTCACAGAGCTC
GATCTGCGGATGCTGGTCTTCCTCGGCGGTGCCCTGCGCACCCGCGAGAAGTGGGACGGC
CTGGCCGCGTCGGCGGGCCTCGTGGTCGAGGAGGTGCGGCAACTGCCGTCGCCGACCATC
CCGTACGACCTCTCGCTCCTCGTCCTTGCCCCCGCGGCCACCGGCGCCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ06528
UniProtKB Entry NameDNRK_STRPE
GenBank Protein ID295169
GenBank Gene IDL13453
General References
  1. Madduri K, Torti F, Colombo AL, Hutchinson CR: Cloning and sequencing of a gene encoding carminomycin 4-O-methyltransferase from Streptomyces peucetius and its expression in Escherichia coli. J Bacteriol. 1993 Jun;175(12):3900-4. [PubMed:8509343]
  2. Madduri K, Hutchinson CR: Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. J Bacteriol. 1995 Jul;177(13):3879-84. [PubMed:7601857]
  3. Jansson A, Koskiniemi H, Mantsala P, Niemi J, Schneider G: Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products. J Biol Chem. 2004 Sep 24;279(39):41149-56. Epub 2004 Jul 24. [PubMed:15273252]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails
DB031994-Methoxy-E-Rhodomycin TexperimentalunknownDetails