Protein-glutamine gamma-glutamyltransferase E

Details

Name
Protein-glutamine gamma-glutamyltransferase E
Synonyms
  • 2.3.2.13
  • TG(E)
  • TGase E
  • TGase-3
  • TGE
  • Transglutaminase E
  • Transglutaminase-3
Gene Name
TGM3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010887|Protein-glutamine gamma-glutamyltransferase E
MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGSNERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGRYTMALQIFSQ
GGISSVKLGTFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIFVGSTNRIGMIGWNFGQ
FEEDILSICLSILDRSLNFRRDAATDVASRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRSWNGSVEILKNWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
SQGVFQCGPASVIGVREGDVQLNFDMPFIFAEVNADRITWLYDNTTGKQWKNSVNSHTIG
RYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQE
PSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSAT
MSLDPEEEAEHPIKISYAQYEKYLKSDNMIRITAVCKVPDESEVVVERDIILDNPTLTLE
VLNEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLGPKEGSRVRFD
ILPSRSGTKQLLADFSCNKFPAIKAMLSIDVAE
Number of residues
693
Molecular Weight
76631.26
Theoretical pI
5.6
GO Classification
Functions
calcium ion binding / catalytic activity / protein-glutamine gamma-glutamyltransferase activity / transferase activity, transferring acyl groups
Processes
cell envelope organization / cellular protein modification process / hair follicle morphogenesis / keratinization / keratinocyte differentiation / peptide cross-linking / protein tetramerization
Components
cytoplasm / extracellular exosome / extrinsic component of cytoplasmic side of plasma membrane
General Function
Transferase activity, transferring acyl groups
Specific Function
Catalyzes the calcium-dependent formation of isopeptide cross-links between glutamine and lysine residues in various proteins, as well as the conjugation of polyamines to proteins. Involved in the formation of the cornified envelope (CE), a specialized component consisting of covalent cross-links of proteins beneath the plasma membrane of terminally differentiated keratinocytes. Catalyzes small proline-rich proteins (SPRR1 and SPRR2) and LOR cross-linking to form small interchain oligomers, which are further cross-linked by TGM1 onto the growing CE scaffold (By similarity). In hair follicles, involved in cross-linking structural proteins to hardening the inner root sheath.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0010888|Protein-glutamine gamma-glutamyltransferase E (TGM3)
ATGGCTGCTCTAGGAGTCCAGAGTATCAACTGGCAGACGGCCTTCAACCGACAAGCGCAT
CACACAGACAAGTTCTCCAGCCAGGAGCTCATCTTGCGGAGAGGCCAAAACTTCCAGGTC
TTAATGATCATGAACAAAGGCCTTGGCTCTAACGAAAGACTGGAGTTCATTGTCTCCACA
GGGCCTTACCCCTCAGAGTCGGCCATGACGAAGGCTGTGTTTCCACTCTCCAATGGCAGT
AGTGGTGGCTGGAGTGCGGTGCTTCAGGCCAGCAATGGCAATACTCTGACTATCAGCATC
TCCAGTCCTGCCAGCGCACCCATAGGACGGTACACAATGGCCCTCCAGATCTTCTCCCAG
GGCGGCATCTCCTCTGTGAAACTTGGGACGTTCATACTGCTTTTTAACCCCTGGCTGAAT
GTGGATAGCGTCTTTATGGGTAACCACGCTGAGAGAGAAGAGTATGTTCAGGAAGATGCC
GGCATCATCTTTGTGGGAAGCACAAACCGAATTGGCATGATTGGCTGGAACTTTGGACAG
TTTGAAGAAGACATTCTCAGCATCTGCCTCTCAATCTTGGATAGGAGTCTGAATTTCCGC
CGTGACGCTGCTACTGATGTGGCCAGCAGAAATGACCCCAAATACGTTGGCCGGGTGCTG
AGTGCCATGATCAATAGCAATGATGACAATGGTGTGCTTGCTGGGAATTGGAGCGGCACT
TACACCGGTGGCCGGGACCCAAGGAGCTGGAACGGCAGCGTGGAGATCCTCAAAAATTGG
AAAAAATCTGGCTTCAGCCCAGTCCGATATGGCCAGTGCTGGGTCTTTGCTGGGACCCTC
AACACAGCGCTGCGGTCTTTGGGGATTCCTTCCCGGGTGATCACCAACTTCAACTCAGCT
CATGACACAGACCGAAATCTCAGTGTGGATGTGTACTACGACCCCATGGGAAACCCCCTG
GACAAGGGTAGTGATAGCGTATGGAATTTCCATGTCTGGAATGAAGGCTGGTTTGTGAGG
TCTGACCTGGGCCCCTCGTACGGTGGATGGCAGGTGTTGGATGCTACCCCGCAGGAAAGA
AGCCAAGGGGTGTTCCAGTGCGGCCCCGCTTCGGTCATTGGTGTTCGAGAGGGTGATGTG
CAGCTGAACTTCGACATGCCCTTTATCTTCGCGGAGGTTAATGCCGACCGCATCACCTGG
CTGTACGACAACACCACTGGCAAACAGTGGAAGAATTCCGTGAACAGTCACACCATTGGC
AGGTACATCAGCACCAAGGCGGTGGGCAGCAATGCTCGCATGGACGTCACGGACAAGTAC
AAGTACCCAGAAGGCTCTGACCAGGAAAGACAAGTGTTCCAAAAGGCTTTGGGGAAACTT
AAACCCAACACGCCATTTGCCGCGACGTCTTCAATGGGTTTGGAAACAGAGGAACAGGAG
CCCAGCATCATCGGGAAGCTGAAGGTCGCTGGCATGCTGGCAGTAGGCAAAGAAGTCAAC
CTGGTCCTACTGCTCAAAAACCTGAGCAGGGATACGAAGACAGTGACAGTGAACATGACA
GCCTGGACCATCATCTACAACGGCACGCTTGTACATGAAGTGTGGAAGGACTCTGCCACA
ATGTCCCTGGACCCTGAGGAAGAGGCAGAACATCCCATAAAGATCTCGTACGCTCAGTAT
GAGAAGTACCTGAAGTCAGACAACATGATCCGGATCACAGCGGTGTGCAAGGTCCCAGAT
GAGTCTGAGGTGGTGGTGGAGCGGGACATCATCCTGGACAACCCCACCTTGACCCTGGAG
GTGCTGAACGAGGCTCGTGTGCGGAAGCCTGTGAACGTGCAGATGCTCTTCTCCAATCCA
CTGGATGAGCCGGTGAGGGACTGCGTGCTGATGGTGGAGGGAAGCGGCCTGCTGTTGGGT
AACCTGAAGATCGACGTGCCGACCCTAGGGCCCAAGGAGGGGTCCCGGGTCCGTTTTGAT
ATCCTGCCCTCCCGGAGTGGCACCAAGCAACTGCTCGCCGACTTCTCCTGCAACAAGTTC
CCTGCAATCAAGGCCATGTTGTCCATCGATGTAGCCGAATGA
Chromosome Location
20
Locus
20q11.2
External Identifiers
ResourceLink
UniProtKB IDQ08188
UniProtKB Entry NameTGM3_HUMAN
GenBank Protein ID307504
GenBank Gene IDL10386
GenAtlas IDTGM3
HGNC IDHGNC:11779
General References
  1. Kim IG, Gorman JJ, Park SC, Chung SI, Steinert PM: The deduced sequence of the novel protransglutaminase E (TGase3) of human and mouse. J Biol Chem. 1993 Jun 15;268(17):12682-90. [PubMed:8099584]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Cheng T, Hitomi K, van Vlijmen-Willems IM, de Jongh GJ, Yamamoto K, Nishi K, Watts C, Reinheckel T, Schalkwijk J, Zeeuwen PL: Cystatin M/E is a high affinity inhibitor of cathepsin V and cathepsin L by a reactive site that is distinct from the legumain-binding site. A novel clue for the role of cystatin M/E in epidermal cornification. J Biol Chem. 2006 Jun 9;281(23):15893-9. Epub 2006 Mar 24. [PubMed:16565075]
  6. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  8. Ahvazi B, Kim HC, Kee SH, Nemes Z, Steinert PM: Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation. EMBO J. 2002 May 1;21(9):2055-67. [PubMed:11980702]
  9. Ahvazi B, Boeshans KM, Idler W, Baxa U, Steinert PM: Roles of calcium ions in the activation and activity of the transglutaminase 3 enzyme. J Biol Chem. 2003 Jun 27;278(26):23834-41. Epub 2003 Apr 4. [PubMed:12679341]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB018645'-Guanosine-Diphosphate-MonothiophosphateexperimentalunknownDetails
DB01972Guanosine-5'-MonophosphateexperimentalunknownDetails
DB03152B-2-OctylglucosideexperimentalunknownDetails
DB04315Guanosine-5'-DiphosphateexperimentalunknownDetails
DB00130L-Glutamineapproved, investigational, nutraceuticalunknownsubstrateDetails