Dihydroorotate dehydrogenase (quinone), mitochondrial

Details

Name
Dihydroorotate dehydrogenase (quinone), mitochondrial
Synonyms
  • 1.3.5.2
  • DHOdehase
  • Dihydroorotate oxidase
Gene Name
Not Available
Organism
Plasmodium falciparum (isolate 3D7)
Amino acid sequence
>lcl|BSEQ0010424|Dihydroorotate dehydrogenase (quinone), mitochondrial
MISKLKPQFMFLPKKHILSYCRKDVLNLFEQKFYYTSKRKESNNMKNESLLRLINYNRYY
NKIDSNNYYNGGKILSNDRQYIYSPLCEYKKKINDISSYVSVPFKINIRNLGTSNFVNNK
KDVLDNDYIYENIKKEKSKHKKIIFLLFVSLFGLYGFFESYNPEFFLYDIFLKFCLKYID
GEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKL
GFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEED
KLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKL
KNIILSVKEEIDNLEKNNIMNDESTYNEDNKIVEKKNNFNKNNSHMMKDAKDNFLWFNTT
KKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAK
LKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAV
QIKRELNHLLYQRGYYNLKEAIGRKHSKS
Number of residues
569
Molecular Weight
65557.87
Theoretical pI
9.44
GO Classification
Functions
dihydroorotate dehydrogenase activity
Processes
'de novo' pyrimidine nucleobase biosynthetic process / 'de novo' UMP biosynthetic process / response to drug
Components
integral component of membrane / mitochondrial inner membrane
General Function
Dihydroorotate dehydrogenase activity
Specific Function
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
Pfam Domain Function
Transmembrane Regions
143-163
Cellular Location
Mitochondrion inner membrane
Gene sequence
>lcl|BSEQ0010425|Dihydroorotate dehydrogenase (quinone), mitochondrial
ATGATCTCTAAATTGAAACCTCAATTTATGTTTTTACCAAAGAAACATATTTTAAGTTAT
TGTAGAAAGGATGTTTTAAATTTGTTTGAACAGAAGTTTTATTATACTAGCAAACGGAAA
GAAAGTAATAATATGAAGAATGAATCTTTATTAAGATTAATTAATTATAATAGATATTAT
AATAAGATAGATTCTAATAATTATTATAATGGTGGAAAAATATTAAGTAATGATAGGCAA
TATATATATTCACCATTATGTGAATATAAAAAGAAAATAAATGATATATCATCATATGTA
TCTGTACCTTTTAAGATTAATATAAGAAATTTAGGTACTTCCAATTTTGTAAATAATAAG
AAGGATGTACTTGATAATGATTATATTTATGAAAATATTAAAAAAGAAAAATCTAAGCAT
AAAAAAATAATATTTTTATTATTTGTTTCATTATTTGGATTATATGGTTTTTTTGAATCT
TATAATCCTGAATTTTTTTTATATGATATATTTTTAAAATTCTGTTTAAAATATATTGAT
GGTGAAATATGTCATGACCTTTTTTTATTACTAGGAAAATATAATATATTACCATATGAT
ACTAGTAATGATAGTATATATGCATGTACAAATATTAAACATCTTGATTTTATAAATCCA
TTCGGTGTTGCTGCAGGATTTGATAAAAACGGTGTATGTATAGATAGCATATTAAAATTA
GGGTTTTCGTTTATCGAAATTGGTACCATAACCCCAAGGGGCCAAACGGGTAATGCAAAA
CCACGTATTTTTAGAGACGTTGAATCTAGAAGTATTATAAATTCATGTGGCTTTAATAAT
ATGGGTTGTGACAAAGTTACAGAAAATTTAATACTTTTTCGTAAAAGACAAGAAGAAGAT
AAATTGTTAAGTAAACATATTGTAGGTGTCAGTATAGGTAAGAATAAAGATACTGTTAAT
ATTGTAGATGATCTAAAATATTGTATTAATAAAATAGGAAGATACGCTGATTATATAGCT
ATTAATGTAAGCTCCCCTAATACACCTGGGTTAAGAGATAATCAAGAAGCTGGGAAGTTA
AAAAATATAATTTTAAGTGTAAAAGAAGAAATAGATAATTTAGAAAAGAATAATATTATG
AATGATGAAAGTACTTATAATGAAGATAATAAAATAGTAGAAAAAAAAAATAATTTTAAT
AAAAATAATAGTCACATGATGAAAGATGCTAAGGATAACTTCTTATGGTTTAATACAACA
AAAAAGAAGCCCTTGGTTTTTGTTAAGTTAGCTCCAGATCTTAATCAAGAACAGAAAAAA
GAAATTGCTGATGTATTACTTGAAACTAATATAGATGGTATGATTATTTCTAATACTACG
ACACAAATAAATGACATAAAAAGTTTTGAAAATAAAAAAGGAGGTGTTAGCGGAGCAAAA
CTAAAAGATATATCTACAAAATTTATATGTGAAATGTATAATTATACAAATAAACAAATA
CCCATTATTGCATCAGGAGGGATATTTAGTGGATTGGATGCTTTAGAAAAAATTGAAGCA
GGTGCTTCAGTTTGTCAATTATATTCTTGTTTGGTTTTTAATGGTATGAAATCAGCTGTA
CAAATAAAAAGAGAATTGAATCACTTGCTATATCAAAGAGGATATTACAATTTAAAGGAG
GCCATTGGCCGAAAGCATAGCAAAAGTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ08210
UniProtKB Entry NamePYRD_PLAF7
GenBank Protein ID46362265
GenBank Gene IDCR382398
General References
  1. LeBlanc SB, Wilson CM: The dihydroorotate dehydrogenase gene homologue of Plasmodium falciparum. Mol Biochem Parasitol. 1993 Aug;60(2):349-51. [PubMed:8232427]
  2. Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [PubMed:12368864]
  3. Hall N, Pain A, Berriman M, Churcher C, Harris B, Harris D, Mungall K, Bowman S, Atkin R, Baker S, Barron A, Brooks K, Buckee CO, Burrows C, Cherevach I, Chillingworth C, Chillingworth T, Christodoulou Z, Clark L, Clark R, Corton C, Cronin A, Davies R, Davis P, Dear P, Dearden F, Doggett J, Feltwell T, Goble A, Goodhead I, Gwilliam R, Hamlin N, Hance Z, Harper D, Hauser H, Hornsby T, Holroyd S, Horrocks P, Humphray S, Jagels K, James KD, Johnson D, Kerhornou A, Knights A, Konfortov B, Kyes S, Larke N, Lawson D, Lennard N, Line A, Maddison M, McLean J, Mooney P, Moule S, Murphy L, Oliver K, Ormond D, Price C, Quail MA, Rabbinowitsch E, Rajandream MA, Rutter S, Rutherford KM, Sanders M, Simmonds M, Seeger K, Sharp S, Smith R, Squares R, Squares S, Stevens K, Taylor K, Tivey A, Unwin L, Whitehead S, Woodward J, Sulston JE, Craig A, Newbold C, Barrell BG: Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13. Nature. 2002 Oct 3;419(6906):527-31. [PubMed:12368867]
  4. Hurt DE, Widom J, Clardy J: Structure of Plasmodium falciparum dihydroorotate dehydrogenase with a bound inhibitor. Acta Crystallogr D Biol Crystallogr. 2006 Mar;62(Pt 3):312-23. Epub 2006 Feb 22. [PubMed:16510978]
  5. Deng X, Gujjar R, El Mazouni F, Kaminsky W, Malmquist NA, Goldsmith EJ, Rathod PK, Phillips MA: Structural plasticity of malaria dihydroorotate dehydrogenase allows selective binding of diverse chemical scaffolds. J Biol Chem. 2009 Sep 25;284(39):26999-7009. doi: 10.1074/jbc.M109.028589. Epub 2009 Jul 28. [PubMed:19640844]
  6. Booker ML, Bastos CM, Kramer ML, Barker RH Jr, Skerlj R, Sidhu AB, Deng X, Celatka C, Cortese JF, Guerrero Bravo JE, Crespo Llado KN, Serrano AE, Angulo-Barturen I, Jimenez-Diaz MB, Viera S, Garuti H, Wittlin S, Papastogiannidis P, Lin JW, Janse CJ, Khan SM, Duraisingh M, Coleman B, Goldsmith EJ, Phillips MA, Munoz B, Wirth DF, Klinger JD, Wiegand R, Sybertz E: Novel inhibitors of Plasmodium falciparum dihydroorotate dehydrogenase with anti-malarial activity in the mouse model. J Biol Chem. 2010 Oct 22;285(43):33054-64. doi: 10.1074/jbc.M110.162081. Epub 2010 Aug 11. [PubMed:20702404]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01117AtovaquoneapprovedyesinhibitorDetails