Apolipoprotein B receptor

Details

Name
Apolipoprotein B receptor
Synonyms
  • apoB-48R
  • APOB48R
  • Apolipoprotein B-100 receptor
  • Apolipoprotein B-48 receptor
  • Apolipoprotein B48 receptor
Gene Name
APOBR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037296|Apolipoprotein B receptor
MDFLRLYLPGLHQALRGALDSLGTFVSYLLGDAVPTVEREAQAAEELGVVAVGKTGKIVE
EEAQEDLEGLRGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGA
GETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNREERLRSWEQEE
EEEEVRAREPGMARGAESEWTWHGETEGKAGAVGPKAAGDNREMEQGVREADAGETEEPG
AEGAGKGEEVVVVEKACESTRAWGTWGPGAEPEDWGILGREEARTTPGREEARAILDGEE
ARTISGGEEAETASGGEEAETASGGEEAGTASGGEEAGIASGGEAGTASGGEEAGTASGG
DEAWTTSGKEEADLLGVRQTEYGAVPGERLLEATGKVWVLEEEGDEEREAEVSPFPKQPQ
VLGTERTEEAAESQTAGREAVGGQEAGESFEGQVDLRGKEAEMRQDLGIRADRARMEELV
QAEEAQEERGSSRDPVAELPSDGEAEGTADLEATPEARPEEELTGEESEAAQTSCGLLGV
EWGGLTHSVTKGQGPELMGGAQTPTKQPEEREAGEVELMGVLALSKEEQERSLEAGPRHA
GSVKPEASEAFPGAWENRTRKDMERGNTQEDAADGEQREEEETAGGQTLAAEAEGDRESE
LSEVPEAGGEGLTTQDAGCGTEEGEASVSENQELDGSTGADAGPCPSLGEAYARETEDEE
AEADRTSRRGWRLQAVAVGLPDREDAQTGSVAAGIMGGDVVPHISAAGAGEALEGVLGQG
WDSKEKEEAAAGEHAGGQEFGLEGSAEEEVTGRGSQVEAFESREGGPWGGRVEAEESAGA
EDSCGLDPAGSQTARAEGMGAMVEAGGLLEKWTLLEEEAVGWQEREQREDSEGRCGDYHP
EGEAPRLLDAEGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAPESVGEAETA
EAMGSARGGAANSWSEAPLPGSLLDVSVPRSRVHLSRSSSQRRSRPSFRRTPAWEQQEEP
PAPNPPEEELSAPEQRPLQLEEPLEPSPLRHDGTPVPARRRPLGHGFGLAHPGMMQELQA
RLGRPKPQ
Number of residues
1088
Molecular Weight
114873.425
Theoretical pI
Not Available
GO Classification
Functions
very-low-density lipoprotein particle receptor activity
Processes
cholesterol metabolic process / lipid transport / receptor-mediated endocytosis / triglyceride metabolic process
Components
chylomicron / low-density lipoprotein particle / membrane / plasma membrane / very-low-density lipoprotein particle
General Function
Very-low-density lipoprotein particle receptor activity
Specific Function
Macrophage receptor that binds to the apolipoprotein B48 (APOB) of dietary triglyceride (TG)-rich lipoproteins (TRL) or to a like domain of APOB in hypertriglyceridemic very low density lipoprotein (HTG-VLDL). Binds and internalizes TRL when out of the context of the macrophage. May provide essential lipids to reticuloendothelial cells. Could also be involved in foam cell formation with elevated TRL and remnant lipoprotein (RLP). Mediates the rapid high-affinity uptake of chylomicrons (CM), HTG-VLDL, and trypsinized (tryp) VLDL devoid of APOE in vitro in macrophages.
Pfam Domain Function
Not Available
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0013964|Apolipoprotein B receptor (APOBR)
ATGGACTTCCTCCGGCTATACCTCCCTGGGCTGCACCAGGCCTTGAGGGGGGCACTGGAT
TCCCTCGGCACCTTTGTCTCCTACCTCCTGGGAGATGCAGTCCCCACTGTAGAGCGGGAG
GCGCAGGCGGCTGAGGAACTGGGGGTGGTGGCGGTGGGAAAGACAGGGAAGATTGTAGAG
GAGGAAGCCCAGGAGGACCTGGAGGGCCTTAGAGGCAGCCAAAACGAGGGGGCTGGAAGG
CTGAGAGGGCCTGGAGATGACAGAAGACATGAAGTGGGGAGCTCAGCTGTAGAACAGACC
TGGGGCTGGGGAGATGGCAGCTCCCATGGGTCCCAAGCAGAGAGGCAGGACAGTGGGGCT
GGGGAGACAGCCAAGGCTGCCAGGTGCCAGGAGCCAAGCGCCCACTTGGAGGCCAGAAAG
AAATCCAAGGCAGGGTCTGGGGCTTGCCAAGACAGGAGCGGCCAAGCCCAGGAGAGGCAG
GAGTCCCATGAGCAGGAAGTGAACAGAGAAGAGAGGCTGAGAAGCTGGGAACAGGAGGAG
GAGGAGGAAGAGGTCAGGGCAAGAGAGCCAGGGATGGCCAGAGGGGCGGAGTCAGAGTGG
ACCTGGCATGGGGAGACGGAGGGGAAGGCTGGTGCTGTTGGGCCAAAGGCGGCAGGGGAC
AACCGGGAGATGGAGCAGGGGGTCAGGGAGGCAGATGCAGGGGAAACTGAGGAGCCTGGG
GCCGAAGGGGCTGGGAAAGGAGAAGAGGTGGTAGTGGTGGAGAAGGCCTGTGAAAGCACT
AGGGCATGGGGGACGTGGGGCCCAGGGGCAGAGCCTGAGGACTGGGGAATCTTAGGCAGA
GAGGAGGCCAGGACAACCCCAGGTAGGGAAGAGGCCAGGGCAATTTTAGATGGGGAGGAA
GCCAGGACAATCTCAGGCGGGGAGGAGGCTGAGACAGCCTCAGGCGGGGAGGAGGCTGAA
ACAGCCTCAGGCGGGGAGGAGGCCGGGACAGCCTCGGGAGGGGAGGAGGCCGGGATAGCC
TCAGGCGGGGAGGCTGGGACAGCCTCAGGAGGGGAGGAGGCCGGGACAGCCTCAGGAGGG
GAGGAGGCCGGGACAGCCTCAGGAGGGGACGAGGCCTGGACAACCTCAGGCAAAGAGGAG
GCTGACCTGCTGGGAGTCAGACAGACAGAATATGGAGCAGTCCCAGGAGAAAGGCTCCTA
GAGGCTACTGGAAAAGTCTGGGTCCTAGAGGAGGAGGGGGATGAGGAGAGAGAGGCTGAG
GTGAGCCCTTTCCCCAAACAGCCCCAGGTCCTGGGCACTGAAAGAACAGAAGAGGCTGCT
GAGAGCCAGACCGCAGGGAGGGAAGCTGTGGGAGGCCAGGAGGCAGGGGAGAGCTTTGAG
GGCCAGGTAGACCTGCGTGGTAAGGAGGCTGAGATGAGGCAGGACTTGGGGATCAGGGCC
GACCGGGCCAGGATGGAAGAGCTGGTACAGGCAGAGGAGGCCCAGGAGGAGAGAGGGAGC
AGCAGGGATCCAGTGGCTGAGCTGCCCTCAGATGGAGAGGCTGAAGGCACTGCCGACTTG
GAGGCAACTCCAGAGGCCAGGCCTGAGGAGGAGCTCACAGGGGAGGAGAGTGAGGCGGCC
CAGACTAGCTGTGGCCTACTGGGCGTGGAATGGGGTGGCCTCACACACAGCGTCACCAAA
GGCCAAGGACCTGAGCTGATGGGGGGCGCCCAGACCCCAACTAAGCAACCCGAGGAAAGG
GAGGCAGGGGAGGTGGAGCTCATGGGAGTTCTGGCCCTGAGCAAAGAGGAGCAGGAGAGG
AGCCTGGAGGCAGGTCCCAGGCACGCGGGGTCTGTAAAGCCTGAGGCCTCCGAGGCCTTC
CCAGGAGCCTGGGAAAACCGCACGAGAAAGGACATGGAGAGAGGAAATACTCAGGAGGAT
GCGGCCGATGGCGAGCAGCGGGAGGAGGAGGAGACTGCGGGAGGCCAGACCCTGGCGGCT
GAGGCTGAAGGAGACCGAGAGTCTGAACTATCAGAAGTCCCAGAGGCAGGCGGGGAGGGG
CTGACAACCCAGGACGCGGGATGTGGAACTGAGGAGGGAGAGGCATCTGTCTCAGAGAAC
CAGGAGCTGGACGGAAGCACAGGGGCAGACGCAGGGCCTTGCCCGTCACTGGGAGAGGCC
TATGCCAGAGAAACTGAGGATGAGGAGGCGGAGGCTGACAGAACATCCAGAAGAGGCTGG
AGGCTGCAAGCGGTGGCTGTGGGCCTCCCGGACCGTGAGGATGCACAGACTGGCTCTGTG
GCTGCTGGGATTATGGGGGGTGATGTGGTCCCACACATCAGCGCTGCTGGCGCTGGTGAA
GCTTTGGAAGGGGTGCTTGGGCAAGGCTGGGACTCGAAAGAAAAGGAAGAGGCAGCAGCA
GGAGAGCATGCAGGTGGGCAAGAATTTGGTCTGGAGGGCTCAGCAGAGGAAGAGGTGACT
GGCAGAGGCAGCCAAGTAGAGGCTTTTGAGTCCAGGGAGGGAGGACCTTGGGGAGGGCGG
GTAGAGGCCGAGGAATCTGCAGGCGCAGAGGACAGCTGTGGGCTGGATCCCGCGGGCTCC
CAGACAGCGAGGGCAGAGGGGATGGGAGCCATGGTGGAGGCTGGGGGGCTTCTAGAAAAG
TGGACGCTGTTGGAAGAAGAGGCTGTTGGATGGCAGGAGAGAGAACAGAGGGAAGACAGT
GAGGGGCGGTGTGGGGACTACCACCCTGAGGGAGAGGCACCAAGGCTCCTTGATGCAGAG
GGTCTCATGGTGACCGGGGGCCGGAGGGCAGAGGCCAAGGAGACTGAGCCAGAAAGCCTG
GAACATGTCAGGGGCCAGGAGGAGCAGCCAACACACCAGGCCCCTGCAGAAGCTGCGCCG
GAGTCAGTCGGGGAAGCCGAGACGGCTGAGGCCATGGGCAGTGCCAGAGGAGGTGCTGCC
AACAGCTGGAGCGAGGCCCCGCTCCCCGGGTCCCTCCTAGACGTCTCTGTCCCAAGGAGT
CGCGTGCACCTCTCGAGAAGCTCCTCACAGCGTCGCTCCCGGCCCTCTTTTCGTCGGACT
CCGGCCTGGGAGCAGCAGGAGGAGCCCCCAGCCCCCAACCCTCCTGAGGAGGAGCTGTCA
GCTCCTGAGCAGAGACCCCTCCAGCTGGAGGAACCCCTGGAGCCAAGCCCTCTGAGGCAT
GATGGGACCCCGGTGCCAGCCAGGAGAAGGCCCCTGGGACACGGGTTTGGCCTCGCGCAC
CCTGGCATGATGCAGGAGCTGCAAGCCCGTCTGGGCCGGCCTAAGCCCCAGTGA
Chromosome Location
16
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ0VD83
UniProtKB Entry NameAPOBR_HUMAN
HGNC IDHGNC:24087
General References
  1. Brown ML, Ramprasad MP, Umeda PK, Tanaka A, Kobayashi Y, Watanabe T, Shimoyamada H, Kuo WL, Li R, Song R, Bradley WA, Gianturco SH: A macrophage receptor for apolipoprotein B48: cloning, expression, and atherosclerosis. Proc Natl Acad Sci U S A. 2000 Jun 20;97(13):7488-93. [PubMed:10852956]
  2. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Bradley WA, Brown ML, Ramprasad MP, Li R, Song R, Gianturco SH: Antipeptide antibodies reveal interrelationships of MBP 200 and MBP 235: unique apoB-specific receptors for triglyceride-rich lipoproteins on human monocyte-macrophages. J Lipid Res. 1999 Apr;40(4):744-52. [PubMed:10191299]
  6. Ramprasad MP, Li R, Bradley WA, Gianturco SH: Human THP-1 monocyte-macrophage membrane binding proteins: distinct receptor(s) for triglyceride-rich lipoproteins. Biochemistry. 1995 Jul 18;34(28):9126-35. [PubMed:7619811]
  7. Gianturco SH, Ramprasad MP, Song R, Li R, Brown ML, Bradley WA: Apolipoprotein B-48 or its apolipoprotein B-100 equivalent mediates the binding of triglyceride-rich lipoproteins to their unique human monocyte-macrophage receptor. Arterioscler Thromb Vasc Biol. 1998 Jun;18(6):968-76. [PubMed:9633939]
  8. Haraguchi G, Kobayashi Y, Brown ML, Tanaka A, Isobe M, Gianturco SH, Bradley WA: PPAR(alpha) and PPAR(gamma) activators suppress the monocyte-macrophage apoB-48 receptor. J Lipid Res. 2003 Jun;44(6):1224-31. Epub 2003 Apr 16. [PubMed:12700342]
  9. Kawakami A, Tani M, Chiba T, Yui K, Shinozaki S, Nakajima K, Tanaka A, Shimokado K, Yoshida M: Pitavastatin inhibits remnant lipoprotein-induced macrophage foam cell formation through ApoB48 receptor-dependent mechanism. Arterioscler Thromb Vasc Biol. 2005 Feb;25(2):424-9. Epub 2004 Dec 9. [PubMed:15591219]
  10. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  11. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]
  12. Fujita Y, Ezura Y, Bujo H, Nakajima T, Takahashi K, Kamimura K, Iino Y, Katayama Y, Saito Y, Emi M: Association of nucleotide variations in the apolipoprotein B48 receptor gene (APOB48R) with hypercholesterolemia. J Hum Genet. 2005;50(4):203-9. Epub 2005 Apr 14. [PubMed:15830122]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB11251Tocopherolapproved, investigationalnotransporterDetails
DB14003alpha-Tocopherol acetateapprovednotransporterDetails
DB11635TocofersolanapprovednosubstrateDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails