Calcium-activated potassium channel subunit alpha-1

Details

Name
Calcium-activated potassium channel subunit alpha-1
Synonyms
  • BK channel
  • BKCA alpha
  • Calcium-activated potassium channel, subfamily M subunit alpha-1
  • hSlo
  • K(VCA)alpha
  • KCa1.1
  • KCNMA
  • Maxi K channel
  • MaxiK
  • SLO
  • Slo homolog
  • Slo-alpha
  • Slo1
  • Slowpoke homolog
Gene Name
KCNMA1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001104|Calcium-activated potassium channel subunit alpha-1
MANGGGGGGGSSGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSSS
VHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCH
CGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVL
VVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKL
WFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKL
VNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYA
KTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLES
VSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVK
IESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSW
NWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNE
MYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLG
FFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERD
CSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQRNGGMRNSPN
TSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSG
HVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVS
ILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIG
VLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDD
DPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEEN
ALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRL
RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSS
KKSSSVHSIPSTANRQNRPKSRESRDKQKYVQEERL
Number of residues
1236
Molecular Weight
137558.115
Theoretical pI
7.07
GO Classification
Functions
actin binding / calcium-activated potassium channel activity / large conductance calcium-activated potassium channel activity / metal ion binding / voltage-gated potassium channel activity
Processes
adult walking behavior / auditory receptor cell differentiation / blood coagulation / cell maturation / cellular potassium ion homeostasis / eye blink reflex / locomotor rhythm / micturition / negative regulation of cell volume / neuromuscular process controlling balance / neuronal action potential / positive regulation of apoptotic process / potassium ion transmembrane transport / potassium ion transport / protein homooligomerization / regulation of aldosterone metabolic process / regulation of membrane potential / relaxation of vascular smooth muscle / response to calcium ion / response to carbon monoxide / response to hypoxia / response to osmotic stress / saliva secretion / sensory perception of sound / smooth muscle contraction involved in micturition / synaptic transmission
Components
apical plasma membrane / caveola / endoplasmic reticulum / external side of plasma membrane / extracellular exosome / integral component of membrane / plasma membrane / postsynaptic membrane / terminal bouton / voltage-gated potassium channel complex
General Function
Voltage-gated potassium channel activity
Specific Function
Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX).
Pfam Domain Function
Transmembrane Regions
87-107 179-199 215-235 240-260 265-285 301-321 368-388
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021262|Calcium-activated potassium channel subunit alpha-1 (KCNMA1)
ATGGCAAATGGTGGCGGCGGCGGCGGCGGCAGCAGCGGCGGCGGCGGCGGCGGCGGAGGC
AGCAGTCTTAGAATGAGTAGCAATATCCACGCGAACCATCTCAGCCTAGACGCGTCCTCC
TCCTCCTCCTCCTCCTCTTCCTCTTCTTCTTCTTCCTCCTCCTCTTCCTCCTCGTCCTCG
GTCCACGAGCCCAAGATGGATGCGCTCATCATCCCGGTGACCATGGAGGTGCCGTGCGAC
AGCCGGGGCCAACGCATGTGGTGGGCTTTCCTGGCCTCCTCCATGGTGACTTTCTTCGGG
GGCCTCTTCATCATCTTGCTCTGGCGGACGCTCAAGTACCTGTGGACCGTGTGCTGCCAC
TGCGGGGGCAAGACGAAGGAGGCCCAGAAGATTAACAATGGCTCAAGCCAGGCGGATGGC
ACTCTCAAACCAGTGGATGAAAAAGAGGAGGCAGTGGCCGCCGAGGTCGGCTGGATGACC
TCCGTGAAGGACTGGGCGGGGGTGATGATATCCGCCCAGACACTGACTGGCAGAGTCCTG
GTTGTCTTAGTCTTTGCTCTCAGCATCGGTGCACTTGTAATATACTTCATAGATTCATCA
AACCCAATAGAATCCTGCCAGAATTTCTACAAAGATTTCACATTACAGATCGACATGGCT
TTCAACGTGTTCTTCCTTCTCTACTTCGGCTTGCGGTTTATTGCAGCCAACGATAAATTG
TGGTTCTGGCTGGAAGTGAACTCTGTAGTGGATTTCTTCACGGTGCCCCCCGTGTTTGTG
TCTGTGTACTTAAACAGAAGTTGGCTTGGTTTGAGATTTTTAAGAGCTCTGAGACTGATA
CAGTTTTCAGAAATTTTGCAGTTTCTGAATATTCTTAAAACAAGTAATTCCATCAAGCTG
GTGAATCTGCTCTCCATATTTATCAGCACGTGGCTGACTGCAGCCGGGTTCATCCATTTG
GTGGAGAATTCAGGGGACCCATGGGAAAATTTCCAAAACAACCAGGCTCTCACCTACTGG
GAATGTGTCTATTTACTCATGGTCACAATGTCCACCGTTGGTTATGGGGATGTTTATGCA
AAAACCACACTTGGGCGCCTCTTCATGGTCTTCTTCATCCTCGGGGGACTGGCCATGTTT
GCCAGCTACGTCCCTGAAATCATAGAGTTAATAGGAAACCGCAAGAAATACGGGGGCTCC
TATAGTGCGGTTAGTGGAAGAAAGCACATTGTGGTCTGCGGACACATCACTCTGGAGAGT
GTTTCCAACTTCCTGAAGGACTTTCTGCACAAGGACCGGGATGACGTCAATGTGGAGATC
GTTTTTCTTCACAACATCTCCCCCAACCTGGAGCTTGAAGCTCTGTTCAAACGACATTTT
ACTCAGGTGGAATTTTATCAGGGTTCCGTCCTCAATCCACATGATCTTGCAAGAGTCAAG
ATAGAGTCAGCAGATGCATGCCTGATCCTTGCCAACAAGTACTGCGCTGACCCGGATGCG
GAGGATGCCTCGAATATCATGAGAGTAATCTCCATAAAGAACTACCATCCGAAGATAAGA
ATCATCACTCAAATGCTGCAGTATCACAACAAGGCCCATCTGCTAAACATCCCGAGCTGG
AATTGGAAAGAAGGTGATGACGCAATCTGCCTCGCAGAGTTGAAGTTGGGCTTCATAGCC
CAGAGCTGCCTGGCTCAAGGCCTCTCCACCATGCTTGCCAACCTCTTCTCCATGAGGTCA
TTCATAAAGATTGAGGAAGACACATGGCAGAAATACTACTTGGAAGGAGTCTCAAATGAA
ATGTACACAGAATATCTCTCCAGTGCCTTCGTGGGTCTGTCCTTCCCTACTGTTTGTGAG
CTGTGTTTTGTGAAGCTCAAGCTCCTAATGATAGCCATTGAGTACAAGTCTGCCAACCGA
GAGAGCCGAAGCCGAAAGCGTATATTAATTAATCCTGGAAACCATCTTAAGATCCAAGAA
GGTACTTTAGGATTTTTCATCGCAAGTGATGCCAAAGAAGTTAAAAGGGCATTTTTTTAC
TGCAAGGCCTGTCATGATGACATCACAGATCCCAAAAGAATAAAAAAATGTGGCTGCAAA
CGGCTTGAAGATGAGCAGCCGTCAACACTATCACCAAAAAAAAAGCAACGGAATGGAGGC
ATGCGGAACTCACCCAACACCTCGCCTAAGCTGATGAGGCATGACCCCTTGTTAATTCCT
GGCAATGATCAGATTGACAACATGGACTCCAATGTGAAGAAGTACGACTCTACTGGGATG
TTTCACTGGTGTGCACCCAAGGAGATAGAGAAAGTCATCCTGACTCGAAGTGAAGCTGCC
ATGACCGTCCTGAGTGGCCATGTCGTGGTCTGCATCTTTGGCGACGTCAGCTCAGCCCTG
ATCGGCCTCCGGAACCTGGTGATGCCGCTCCGTGCCAGCAACTTTCATTACCATGAGCTC
AAGCACATTGTGTTTGTGGGCTCTATTGAGTACCTCAAGCGGGAATGGGAGACGCTTCAT
AACTTCCCCAAAGTGTCCATATTGCCTGGTACGCCATTAAGTCGGGCTGATTTAAGGGCT
GTCAACATCAACCTCTGTGACATGTGCGTTATCCTGTCAGCCAATCAGAATAATATTGAT
GATACTTCGCTGCAGGACAAGGAATGCATCTTGGCGTCACTCAACATCAAATCTATGCAG
TTTGATGACAGCATCGGAGTCTTGCAGGCTAATTCCCAAGGGTTCACACCTCCAGGAATG
GATAGATCCTCTCCAGATAACAGCCCAGTGCACGGGATGTTACGTCAACCATCCATCACA
ACTGGGGTCAACATCCCCATCATCACTGAACTAGTGAACGATACTAATGTTCAGTTTTTG
GACCAAGACGATGATGATGACCCTGATACAGAACTGTACCTCACGCAGCCCTTTGCCTGT
GGGACAGCATTTGCCGTCAGTGTCCTGGACTCACTCATGAGCGCGACGTACTTCAATGAC
AATATCCTCACCCTGATACGGACCCTGGTGACCGGAGGAGCCACGCCGGAGCTGGAGGCT
CTGATTGCTGAGGAAAACGCCCTTAGAGGTGGCTACAGCACCCCGCAGACACTGGCCAAT
AGGGACCGCTGCCGCGTGGCCCAGTTAGCTCTGCTCGATGGGCCATTTGCGGACTTAGGG
GATGGTGGTTGTTATGGTGATCTGTTCTGCAAAGCTCTGAAAACATATAATATGCTTTGT
TTTGGAATTTACCGGCTGAGAGATGCTCACCTCAGCACCCCCAGTCAGTGCACAAAGAGG
TATGTCATCACCAACCCGCCCTATGAGTTTGAGCTCGTGCCGACGGACCTGATCTTCTGC
TTAATGCAGTTTGACCACAATGCCGGCCAGTCCCGGGCCAGCCTGTCCCATTCCTCCCAC
TCGTCGCAGTCCTCCAGCAAGAAGAGCTCCTCTGTTCACTCCATCCCATCCACAGCAAAC
CGACAGAACCGGCCCAAGTCCAGGGAGTCCCGGGACAAACAGAACAGAAAAGAAATGGTT
TACAGATGA
Chromosome Location
10
Locus
10q22.3
External Identifiers
ResourceLink
UniProtKB IDQ12791
UniProtKB Entry NameKCMA1_HUMAN
GenBank Protein ID537439
GenBank Gene IDU13913
GenAtlas IDKCNMA1
HGNC IDHGNC:6284
General References
  1. Dworetzky SI, Trojnacki JT, Gribkoff VK: Cloning and expression of a human large-conductance calcium-activated potassium channel. Brain Res Mol Brain Res. 1994 Nov;27(1):189-93. [PubMed:7877450]
  2. McCobb DP, Fowler NL, Featherstone T, Lingle CJ, Saito M, Krause JE, Salkoff L: A human calcium-activated potassium channel gene expressed in vascular smooth muscle. Am J Physiol. 1995 Sep;269(3 Pt 2):H767-77. [PubMed:7573516]
  3. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Tseng-Crank J, Foster CD, Krause JD, Mertz R, Godinot N, DiChiara TJ, Reinhart PH: Cloning, expression, and distribution of functionally distinct Ca(2+)-activated K+ channel isoforms from human brain. Neuron. 1994 Dec;13(6):1315-30. [PubMed:7993625]
  6. Mazzone JN, Kaiser RA, Buxton IL: Calcium-activated potassium channel expression in human myometrium: effect of pregnancy. Proc West Pharmacol Soc. 2002;45:184-6. [PubMed:12434576]
  7. Pallanck L, Ganetzky B: Cloning and characterization of human and mouse homologs of the Drosophila calcium-activated potassium channel gene, slowpoke. Hum Mol Genet. 1994 Aug;3(8):1239-43. [PubMed:7987297]
  8. Wallner M, Meera P, Ottolia M, Kaczorowski GJ, Latorre R, Garcia ML, Stefani E, Toro L: Characterization of and modulation by a beta-subunit of a human maxi KCa channel cloned from myometrium. Receptors Channels. 1995;3(3):185-99. [PubMed:8821792]
  9. Liu X, Chang Y, Reinhart PH, Sontheimer H, Chang Y: Cloning and characterization of glioma BK, a novel BK channel isoform highly expressed in human glioma cells. J Neurosci. 2002 Mar 1;22(5):1840-9. [PubMed:11880513]
  10. Wallner M, Meera P, Toro L: Determinant for beta-subunit regulation in high-conductance voltage-activated and Ca(2+)-sensitive K+ channels: an additional transmembrane region at the N terminus. Proc Natl Acad Sci U S A. 1996 Dec 10;93(25):14922-7. [PubMed:8962157]
  11. Meera P, Wallner M, Song M, Toro L: Large conductance voltage- and calcium-dependent K+ channel, a distinct member of voltage-dependent ion channels with seven N-terminal transmembrane segments (S0-S6), an extracellular N terminus, and an intracellular (S9-S10) C terminus. Proc Natl Acad Sci U S A. 1997 Dec 9;94(25):14066-71. [PubMed:9391153]
  12. Diaz L, Meera P, Amigo J, Stefani E, Alvarez O, Toro L, Latorre R: Role of the S4 segment in a voltage-dependent calcium-sensitive potassium (hSlo) channel. J Biol Chem. 1998 Dec 4;273(49):32430-6. [PubMed:9829973]
  13. Wallner M, Meera P, Toro L: Molecular basis of fast inactivation in voltage and Ca2+-activated K+ channels: a transmembrane beta-subunit homolog. Proc Natl Acad Sci U S A. 1999 Mar 30;96(7):4137-42. [PubMed:10097176]
  14. Brenner R, Jegla TJ, Wickenden A, Liu Y, Aldrich RW: Cloning and functional characterization of novel large conductance calcium-activated potassium channel beta subunits, hKCNMB3 and hKCNMB4. J Biol Chem. 2000 Mar 3;275(9):6453-61. [PubMed:10692449]
  15. Quirk JC, Reinhart PH: Identification of a novel tetramerization domain in large conductance K(ca) channels. Neuron. 2001 Oct 11;32(1):13-23. [PubMed:11604135]
  16. Wang YW, Ding JP, Xia XM, Lingle CJ: Consequences of the stoichiometry of Slo1 alpha and auxiliary beta subunits on functional properties of large-conductance Ca2+-activated K+ channels. J Neurosci. 2002 Mar 1;22(5):1550-61. [PubMed:11880485]
  17. Tang XD, Xu R, Reynolds MF, Garcia ML, Heinemann SH, Hoshi T: Haem can bind to and inhibit mammalian calcium-dependent Slo1 BK channels. Nature. 2003 Oct 2;425(6957):531-5. [PubMed:14523450]
  18. Magleby KL: Gating mechanism of BK (Slo1) channels: so near, yet so far. J Gen Physiol. 2003 Feb;121(2):81-96. [PubMed:12566537]
  19. Jeffries O, Geiger N, Rowe IC, Tian L, McClafferty H, Chen L, Bi D, Knaus HG, Ruth P, Shipston MJ: Palmitoylation of the S0-S1 linker regulates cell surface expression of voltage- and calcium-activated potassium (BK) channels. J Biol Chem. 2010 Oct 22;285(43):33307-14. doi: 10.1074/jbc.M110.153940. Epub 2010 Aug 6. [PubMed:20693285]
  20. Tian L, McClafferty H, Knaus HG, Ruth P, Shipston MJ: Distinct acyl protein transferases and thioesterases control surface expression of calcium-activated potassium channels. J Biol Chem. 2012 Apr 27;287(18):14718-25. doi: 10.1074/jbc.M111.335547. Epub 2012 Mar 7. [PubMed:22399288]
  21. Yan J, Aldrich RW: LRRC26 auxiliary protein allows BK channel activation at resting voltage without calcium. Nature. 2010 Jul 22;466(7305):513-6. doi: 10.1038/nature09162. Epub 2010 Jul 7. [PubMed:20613726]
  22. Gordon E, Semus SF, Lozinskaya IM, Lin Z, Xu X: Characterizing the role of Thr352 in the inhibition of the large conductance Ca2+-activated K+ channels by 1-[1-hexyl-6-(methyloxy)-1H-indazol-3-yl]-2-methyl-1-propanone. J Pharmacol Exp Ther. 2010 Aug;334(2):402-9. doi: 10.1124/jpet.110.166017. Epub 2010 Apr 29. [PubMed:20430843]
  23. Yan J, Aldrich RW: BK potassium channel modulation by leucine-rich repeat-containing proteins. Proc Natl Acad Sci U S A. 2012 May 15;109(20):7917-22. doi: 10.1073/pnas.1205435109. Epub 2012 Apr 30. [PubMed:22547800]
  24. Yuan P, Leonetti MD, Pico AR, Hsiung Y, MacKinnon R: Structure of the human BK channel Ca2+-activation apparatus at 3.0 A resolution. Science. 2010 Jul 9;329(5988):182-6. doi: 10.1126/science.1190414. Epub 2010 May 27. [PubMed:20508092]
  25. Du W, Bautista JF, Yang H, Diez-Sampedro A, You SA, Wang L, Kotagal P, Luders HO, Shi J, Cui J, Richerson GB, Wang QK: Calcium-sensitive potassium channelopathy in human epilepsy and paroxysmal movement disorder. Nat Genet. 2005 Jul;37(7):733-8. Epub 2005 Jun 5. [PubMed:15937479]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00356ChlorzoxazoneapprovedyesDetails
DB01003Cromoglicic acidapprovedyesinhibitorDetails
DB00436BendroflumethiazideapprovedyesinducerDetails
DB00774Hydroflumethiazideapproved, investigationalunknownother/unknownDetails
DB01119DiazoxideapprovedunknownotherDetails
DB01159Halothaneapproved, vet_approvedunknowninhibitorDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB00999Hydrochlorothiazideapproved, vet_approvedyesinhibitorDetails
DB04209Dequaliniumapproved, investigationalunknowninhibitorDetails
DB00721Procaineapproved, investigational, vet_approvedunknownbinderDetails
DB09089TrimebutineapprovedyesinhibitorDetails