Hyaluronan-binding protein 2

Details

Name
Hyaluronan-binding protein 2
Synonyms
  • 3.4.21.-
  • Factor seven-activating protease
  • Factor VII-activating protease
  • FSAP
  • Hepatocyte growth factor activator-like protein
  • HGFAL
  • PHBP
  • Plasma hyaluronan-binding protein
Gene Name
HABP2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008719|Hyaluronan-binding protein 2
MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLT
HAENPDWYYTEDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC
GRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPD
QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDS
CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTA
AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSR
QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVY
TQVTKFLNWIKATIKSESGF
Number of residues
560
Molecular Weight
62671.255
Theoretical pI
Not Available
GO Classification
Functions
glycosaminoglycan binding / serine-type endopeptidase activity
Processes
cell adhesion / proteolysis
Components
extracellular region / extracellular space
General Function
Serine-type endopeptidase activity
Specific Function
Cleaves the alpha-chain at multiple sites and the beta-chain between 'Lys-53' and 'Lys-54' but not the gamma-chain of fibrinogen and therefore does not initiate the formation of the fibrin clot and does not cause the fibrinolysis directly. It does not cleave (activate) prothrombin and plasminogen but converts the inactive single chain urinary plasminogen activator (pro-urokinase) to the active two chain form. Activates coagulation factor VII.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0013375|Hyaluronan-binding protein 2 (HABP2)
ATGTCTTTATTGGAAAGCCTGGACCCAGACTGGACCCCTGACCAGTATGATTACAGCTAC
GAGGATTATAATCAGGAAGAGAACACCAGTAGCACACTTACCCACGCTGAGAATCCTGAC
TGGTACTACACTGAGGACCAAGCTGATCCATGCCAGCCCAACCCCTGTGAACACGGTGGG
GACTGCCTCGTCCATGGGAGCACCTTCACATGCAGCTGCCTGGCTCCTTTCTCTGGGAAT
AAGTGTCAGAAAGTGCAAAATACGTGCAAGGACAACCCATGTGGCCGGGGCCAATGTCTC
ATTACCCAGAGTCCTCCCTACTACCGCTGTGTCTGTAAACACCCTTACACAGGTCCCAGC
TGCTCCCAAGTGGTTCCTGTATGCAGGCCAAACCCCTGCCAGAATGGGGCTACCTGCTCC
CGGCATAAGCGGAGATCCAAGTTCACCTGTGCCTGTCCCGACCAGTTCAAGGGGAAATTC
TGTGAAATAGGTTCTGATGACTGCTATGTTGGCGATGGCTACTCTTACCGAGGGAAAATG
AATAGGACAGTCAACCAGCATGCGTGCCTTTACTGGAACTCCCACCTCCTCTTGCAGGAG
AATTACAACATGTTTATGGAGGATGCTGAAACCCATGGGATTGGGGAACACAATTTCTGC
AGAAACCCAGATGCGGACGAAAAGCCCTGGTGCTTTATTAAAGTTACCAATGACAAGGTG
AAATGGGAATACTGTGATGTCTCAGCCTGCTCAGCCCAGGACGTTGCCTACCCAGAGGAA
AGCCCCACTGAGCCATCAACCAAGCTTCCGGGGTTTGACTCCTGTGGAAAGACTGAGATA
GCAGAGAGGAAGATCAAGAGAATCTATGGAGGCTTTAAGAGCACGGCGGGCAAGCACCCA
TGGCAGGCGTCCCTCCAGTCCTCGCTGCCTCTGACCATCTCCATGCCCCAGGGCCACTTC
TGTGGTGGGGCGCTGATCCACCCCTGCTGGGTGCTCACTGCTGCCCACTGCACCGACATA
AAAACCAGACATCTAAAGGTGGTGCTAGGGGACCAGGACCTGAAGAAAGAAGAATTTCAT
GAGCAGAGCTTTAGGGTGGAGAAGATATTCAAGTACAGCCACTACAATGAAAGAGATGAG
ATTCCCCACAATGATATTGCATTGCTCAAGTTAAAGCCAGTGGATGGTCACTGTGCTCTA
GAATCCAAATACGTGAAGACTGTGTGCTTGCCTGATGGGTCCTTTCCCTCTGGGAGTGAG
TGCCACATCTCTGGCTGGGGTGTTACAGAAACAGGAAAAGGGTCCCGCCAGCTCCTGGAT
GCCAAAGTCAAGCTGATTGCCAACACTTTGTGCAACTCCCGCCAACTCTATGACCACATG
ATTGATGACAGTATGATCTGTGCAGGAAATCTTCAGAAACCTGGGCAAGACACCTGCCAG
GGTGACTCTGGAGGCCCCCTGACCTGTGAGAAGGACGGCACCTACTACGTCTATGGGATA
GTGAGCTGGGGCCTGGAGTGTGGGAAGAGGCCAGGGGTCTACACCCAAGTTACCAAATTC
CTGAATTGGATCAAAGCCACCATCAAAAGTGAAAGTGGCTTCTAA
Chromosome Location
10
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ14520
UniProtKB Entry NameHABP2_HUMAN
HGNC IDHGNC:4798
General References
  1. Choi-Miura NH, Tobe T, Sumiya J, Nakano Y, Sano Y, Mazda T, Tomita M: Purification and characterization of a novel hyaluronan-binding protein (PHBP) from human plasma: it has three EGF, a kringle and a serine protease domain, similar to hepatocyte growth factor activator. J Biochem. 1996 Jun;119(6):1157-65. [PubMed:8827452]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Romisch J, Vermohlen S, Feussner A, Stohr H: The FVII activating protease cleaves single-chain plasminogen activators. Haemostasis. 1999;29(5):292-9. [PubMed:10754382]
  6. Choi-Miura NH, Yoda M, Saito K, Takahashi K, Tomita M: Identification of the substrates for plasma hyaluronan binding protein. Biol Pharm Bull. 2001 Feb;24(2):140-3. [PubMed:11217080]
  7. Willeit J, Kiechl S, Weimer T, Mair A, Santer P, Wiedermann CJ, Roemisch J: Marburg I polymorphism of factor VII--activating protease: a prominent risk predictor of carotid stenosis. Circulation. 2003 Feb 11;107(5):667-70. [PubMed:12578864]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08818Hyaluronic acidapproved, vet_approvedunknownbinderDetails