Inositol 1,4,5-trisphosphate receptor type 2

Details

Name
Inositol 1,4,5-trisphosphate receptor type 2
Synonyms
  • InsP3R2
  • IP3 receptor isoform 2
  • IP3R 2
  • Type 2 inositol 1,4,5-trisphosphate receptor
  • Type 2 InsP3 receptor
Gene Name
ITPR2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008690|Inositol 1,4,5-trisphosphate receptor type 2
MTEKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGE
IGESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEHQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGNTLRKILLNRYFKGDYSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLK
EGMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVALVNQNLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFF
FSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPT
IPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
Number of residues
2701
Molecular Weight
308061.11
Theoretical pI
Not Available
GO Classification
Functions
calcium ion binding / calcium ion transmembrane transporter activity / inositol 1,4,5 trisphosphate binding / inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity / phosphatidylinositol binding / scaffold protein binding
Processes
cellular response to cAMP / cellular response to ethanol / platelet activation / regulation of cardiac conduction / regulation of insulin secretion / release of sequestered calcium ion into cytosol / response to hypoxia / signal transduction / transport
Components
cell cortex / endoplasmic reticulum / endoplasmic reticulum membrane / integral component of membrane / membrane / nucleus / plasma membrane / platelet dense tubular network membrane / receptor complex / sarcoplasmic reticulum membrane
General Function
Receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. This release is regulated by cAMP both dependently and independently of PKA (By similarity).
Specific Function
Calcium ion binding
Pfam Domain Function
Transmembrane Regions
2228-2248 2261-2281 2308-2328 2352-2372 2395-2415 2522-2542
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0013356|Inositol 1,4,5-trisphosphate receptor type 2 (ITPR2)
ATGACTGAGAAAATGTCCAGCTTCCTCTACATAGGGGACATCGTGTCCCTGTACGCGGAG
GGCTCGGTCAACGGCTTCATCAGCACCTTGGGGTTAGTGGATGACAGATGTGTGGTGCAC
CCAGAGGCCGGGGACCTTGCCAACCCTCCCAAGAAGTTCAGAGACTGCCTTTTCAAGGTG
TGCCCTATGAACAGATATTCTGCCCAGAAGCAATATTGGAAAGCAAAGCAAGCCAAACAA
GGGAACCACACCGAGGCAGCCTTGCTGAAGAAACTACAGCACGCTGCAGAACTGGAACAA
AAACAAAATGAATCGGAGAATAAGAAACTGTTGGGAGAAATTGTAAAATACAGTAATGTT
ATACAACTACTGCATATAAAAAGCAACAAATATCTTACTGTCAACAAGAGATTACCTGCT
TTACTGGAGAAGAATGCCATGCGTGTGTCCTTGGATGCTGCAGGAAATGAAGGGTCTTGG
TTTTATATTCATCCGTTCTGGAAACTGAGAAGCGAGGGTGACAATATTGTTGTAGGAGAT
AAAGTTGTTTTGATGCCTGTGAATGCAGGGCAGCCACTACATGCCAGCAACATAGAGCTT
CTTGATAACCCAGGGTGTAAAGAGGTGAATGCTGTCAATTGCAACACCAGCTGGAAAATC
ACTTTATTCATGAAATATAGTTCCTATCGAGAGGATGTATTAAAAGGAGGGGACGTTGTT
AGATTATTTCATGCGGAACAAGAGAAGTTTTTGACTTGTGATGAATATGAGAAAAAACAG
CACATTTTCCTTCGTACGACCTTGCGCCAATCAGCTACTTCTGCTACTAGTTCTAAAGCA
CTCTGGGAAATAGAGGTGGTTCATCATGACCCATGCCGTGGGGGTGCAGGACAGTGGAAC
AGCTTGTTCAGATTTAAGCATCTTGCAACTGGAAACTATTTAGCTGCAGAGCTTAATCCT
GATTATCGAGATGCCCAAAATGAAGGAAAAAATGTGAGAGATGGAGTCCCTCCAACTTCA
AAGAAAAAACGCCAGGCAGGGGAGAAGATCATGTATACTTTGGTTTCAGTCCCGCATGGC
AATGACATTGCATCCCTTTTTGAACTAGATGCCACAACTCTTCAGAGAGCTGACTGCCTG
GTTCCAAGGAACTCATATGTTCGGTTAAGGCATTTATGCACCAACACATGGGTAACCAGT
ACTAGTATCCCCATAGACACAGATGAAGAGAGGCCTGTTATGTTAAAGATTGGAACCTGC
CAAACCAAAGAAGATAAAGAAGCGTTCGCAATCGTGTCTGTTCCACTGTCTGAAGTTCGA
GACTTAGACTTTGCCAATGATGCCAATAAAGTACTAGCGACCACAGTTAAAAAGCTAGAA
AACGGCACAATAACTCAGAATGAAAGGAGGTTTGTAACCAAATTATTGGAAGATCTCATA
TTCTTTGTTGCTGATGTGCCTAATAATGGACAAGAAGTTCTGGATGTGGTTATCACTAAG
CCAAACCGAGAGCGTCAAAAATTGATGAGGGAACAAAACATACTGGCACAGGTATTTGGA
ATTCTTAAAGCACCCTTTAAAGAGAAAGCAGGAGAAGGCTCGATGCTGAGACTTGAAGAT
CTGGGGGATCAAAGATATGCACCCTACAAGTACATGCTGCGGCTCTGTTACCGCGTCCTG
AGACACTCGCAGCAGGATTACCGGAAAAATCAGGAATATATTGCTAAGAATTTCTGTGTC
ATGCAGTCCCAGATTGGCTATGATATTTTGGCAGAAGATACTATCACAGCTTTGTTGCAC
AACAACAGAAAACTACTAGAGAAACATATCACAGCAAAAGAAATAGAAACATTTGTCAGT
TTACTCAGGAGAAATCGGGAGCCAAGGTTTTTGGATTATTTGTCAGATCTGTGTGTGTCT
AATACCACTGCTATCCCTGTAACTCAAGAACTCATCTGTAAATTTATGTTGAGTCCAGGC
AATGCAGACATTCTCATTCAAACTAAGGTGGTCTCAATGCAAGCAGACAACCCCATGGAG
AGCTCCATCCTTTCAGATGACATTGATGATGAAGAAGTTTGGCTCTATTGGATTGACAGC
AACAAGGAACCTCATGGCAAAGCTATCAGGCACCTTGCTCAAGAGGCAAAAGAAGGCACC
AAAGCTGACTTAGAAGTTCTTACCTATTACAGGTACCAGCTAAACCTCTTTGCAAGGATG
TGCTTGGATCGCCAGTATCTGGCCATAAACCAGATTTCTACACAGCTGTCTGTAGACCTG
ATCCTGCGGTGTGTGTCGGATGAGAGCCTGCCGTTCGACCTCCGAGCGTCCTTCTGTCGC
CTCATGCTCCACATGCACGTTGACCGGGATCCCCAGGAGTCCGTGGTGCCTGTTCGCTAT
GCCAGGCTCTGGACAGAAATCCCCACAAAGATCACAATTCATGAATATGATTCTATAACA
GACTCTTCCAGAAATGATATGAAGAGGAAATTTGCCCTGACAATGGAATTTGTTGAAGAA
TATTTGAAAGAAGTTGTAAACCAGCCCTTTCCTTTTGGGGATAAAGAAAAAAATAAACTG
ACATTTGAGGTGGTCCACTTGGCTCGGAATCTTATATACTTTGGATTTTATAGTTTCAGT
GAGTTATTAAGGCTAACAAGAACACTTCTGGCTATTTTAGACATTGTACAGGCCCCCATG
TCATCATACTTTGAAAGATTAAGCAAATTTCAAGATGGAGGAAACAATGTGATGAGAACC
ATTCATGGGGTGGGAGAGATGATGACCCAGATGGTACTCAGTAGAGGCTCCATCTTCCCC
ATGAGCGTGCCGGATGTGCCACCCAGCATCCACCCGAGCAAGCAAGGGAGCCCCACCGAG
CACGAGGATGTGACTGTGATGGACACCAAGCTGAAGATCATTGAGATTTTGCAGTTTATC
CTGAGTGTCAGACTGGATTATAGGATCTCATATATGCTGTCAATATATAAGAAGGAGTTT
GGAGAGGACAATGACAATGCGGAGACATCTGCCAGTGGATCTCCAGACACTTTACTACCA
TCAGCTATTGTTCCTGATATAGATGAAATTGCAGCTCAGGCAGAAACTATGTTTGCGGGA
AGAAAAGAAAAAAATCCAGTTCAACTTGACGATGAAGGAGGCAGGACGTTTTTACGGGTC
CTCATTCATCTGATCATGCACGACTACCCGCCTTTGCTGTCTGGAGCCCTGCAGCTGTTG
TTTAAGCACTTCAGCCAGAGGGCAGAGGTTTTACAGGCATTTAAGCAGGTGCAATTACTG
GTGTCTAATCAAGACGTAGATAACTACAAGCAAATCAAGGCAGATCTAGACCAGCTTCGA
CTGACAGTAGAAAAGTCTGAGCTATGGGTGGAGAAGAGCAGCAACTATGAGAATGGAGAA
ATAGGGGAAAGTCAAGTGAAAGGTGGTGAAGAGCCAATTGAGGAATCAAACATTTTAAGT
CCAGTGCAGGATGGAACAAAGAAACCTCAGATTGACAGCAACAAGAGCAATAACTACCGG
ATTGTAAAGGAGATTTTGATCAGGCTAAGTAAACTCTGTGTGCAGAATAAAAAGTGTCGG
AATCAACATCAACGATTACTGAAAAATATGGGGGCGCATTCGGTGGTGTTGGATCTTCTG
CAGATACCCTATGAAAAGAATGATGAAAAGATGAATGAAGTAATGAATCTAGCCCATACA
TTTCTGCAGAATTTCTGTCGAGGAAATCCACAGAATCAAGTTCTTCTTCATAAACATCTG
AATTTGTTTTTAACTCCAGGTCTCCTTGAAGCAGAAACCATGCGGCACATCTTCATGAAC
AATTACCATCTGTGCAACGAAATTAGCGAGAGAGTTGTACAACACTTTGTGCACTGCATT
GAGACACATGGCCGCCACGTGGAGTACCTGAGGTTTTTGCAAACAATTGTAAAAGCAGAT
GGTAAATATGTGAAGAAATGCCAGGATATGGTAATGACAGAGTTGATAAATGGGGGTGAA
GACGTGCTGATATTTTACAATGATAGAGCATCATTTCCAATCCTTCTCCATATGATGTGT
TCAGAGAGAGACCGAGGGGATGAGAGTGGCCCCTTAGCCTACCACATCACCCTGGTGGAG
TTGCTGGCAGCATGCACAGAGGGGAAAAATGTCTACACTGAAATCAAGTGTAATTCCCTT
CTCCCGCTGGACGACATAGTGAGGGTGGTGACCCATGACGACTGCATCCCTGAGGTTAAA
ATTGCTTATGTGAACTTTGTTAATCACTGTTATGTTGACACTGAAGTGGAAATGAAAGAA
ATCTATACAAGTAACCACATTTGGAAATTATTTGAGAACTTCTTGGTGGATATGGCAAGG
GTTTGCAACACAACTACAGACAGGAAACATGCAGACATCTTTTTGGAAAAGTGTGTTACT
GAGTCAATAATGAATATTGTGAGCGGCTTCTTTAATTCTCCCTTTTCAGACAATAGTACC
AGCCTCCAGACACATCAGCCAGTTTTTATTCAGCTACTGCAATCTGCCTTCAGAATTTAC
AATTGCACCTGGCCAAACCCAGCGCAGAAAGCCTCAGTGGAATCCTGTATCAGAACTTTG
GCTGAAGTGGCAAAAAATCGTGGAATTGCCATTCCAGTGGATTTGGACAGCCAAGTTAAT
ACTCTTTTCATGAAGAGCCATTCAAATATGGTGCAGAGAGCAGCAATGGGTTGGAGACTA
TCAGCTCGCTCTGGGCCACGCTTTAAGGAAGCTCTTGGAGGGCCTGCTTGGGATTACAGA
AATATTATTGAAAAGTTACAGGATGTAGTGGCCTCCTTGGAGCACCAGTTCAGCCCAATG
ATGCAGGCTGAATTCTCAGTGTTGGTTGATGTATTGTACAGTCCAGAACTGCTGTTCCCT
GAGGGAAGCGATGCAAGAATAAGATGTGGCGCTTTCATGTCGAAGTTGATTAATCATACA
AAGAAACTAATGGAGAAAGAAGAAAAACTGTGCATTAAAATTCTTCAGACATTACGAGAA
ATGTTAGAGAAGAAAGACAGCTTTGTGGAAGAGGGTAACACATTAAGAAAGATACTTCTG
AATCGATACTTTAAAGGTGATTATAGTATTGGTGTGAATGGACACCTATCAGGAGCCTAC
TCCAAAACTGCACAGGTGGGAGGAAGCTTTTCTGGACAAGATTCAGATAAGATGGGGATA
TCAATGTCAGACATTCAGTGTCTGCTGGATAAAGAAGGTGCATCAGAACTTGTCATCGAT
GTTATAGTGAACACCAAAAATGACAGAATTTTTTCAGAAGGCATTTTCCTCGGCATTGCC
TTGCTTGAAGGAGGAAATACACAAACACAGTATTCTTTCTACCAGCAGTTGCATGAACAA
AAAAAGTCAGAAAAATTCTTTAAAGTTCTCTATGATCGAATGAAGGCTGCTCAGAAAGAA
ATAAGATCAACAGTGACAGTTAATACCATAGATTTAGGTAACAAAAAAAGGGACGATGAC
AATGAATTGATGACATCTGGTCCACGAATGAGAGTAAGAGATTCAACACTACATTTAAAA
GAGGGAATGAAAGGGCAATTAACAGAAGCTTCTTCAGCAACATCCAAAGCATATTGTGTA
TACAGAAGAGAAATGGATCCAGAAATAGACATTATGTGCACAGGACCAGAAGCGGGAAAC
ACTGAGGAAAAATCCGCAGAGGAAGTAACAATGAGTCCCGCAATTGCCATCATGCAGCCA
ATACTGAGATTTCTTCAGTTACTGTGTGAGAATCACAACCGGGAATTGCAGAACTTCTTG
AGGAATCAAAACAACAAAACAAATTACAACCTAGTCTGTGAGACCCTTCAGTTTCTGGAC
TGCATTTGTGGAAGTACAACCGGTGGCCTGGGCCTGTTGGGTCTCTACATCAATGAGAAG
AATGTAGCGCTGGTCAACCAGAACCTGGAGAGCTTGACTGAGTATTGCCAGGGCCCTTGC
CATGAAAATCAGACCTGTATCGCTACACATGAGTCTAATGGGATTGATATCATCATTGCT
TTGATTCTGAATGACATAAACCCTCTTGGTAAATACCGAATGGACCTGGTGCTCCAGCTA
AAGAACAATGCATCTAAACTTTTGCTGGCCATTATGGAAAGCAGACATGACAGTGAGAAT
GCAGAAAGAATTCTTTTTAACATGAGACCCAGAGAACTGGTGGATGTGATGAAGAATGCC
TATAACCAAGGATTGGAATGTGACCATGGGGATGATGAGGGTGGAGATGATGGTGTTTCT
CCAAAAGATGTTGGACACAATATCTATATTCTGGCCCATCAGTTGGCCCGCCACAATAAA
CTGTTGCAGCAGATGCTCAAACCAGGATCGGATCCAGATGAAGGAGATGAAGCCTTAAAG
TATTATGCCAACCACACTGCACAGATTGAGATTGTCCGGCATGATAGGACCATGGAACAA
ATAGTTTTTCCTGTCCCCAATATATGTGAATACCTCACTCGAGAATCCAAGTGCCGTGTG
TTCAATACAACTGAAAGGGATGAACAAGGAAGTAAAGTGAATGACTTTTTCCAGCAAACA
GAAGATCTCTACAATGAAATGAAGTGGCAGAAGAAAATCAGGAATAACCCTGCACTGTTC
TGGTTCTCGAGGCACATCTCTCTCTGGGGGAGCATTTCCTTCAACCTGGCTGTGTTCATC
AATTTAGCTGTTGCTCTCTTCTACCCATTTGGGGATGATGGAGATGAAGGTACACTTTCT
CCATTGTTCTCGGTTCTTCTTTGGATAGCAGTTGCGATCTGCACATCTATGCTGTTTTTC
TTCTCCAAGCCTGTGGGTATTCGGCCGTTTCTTGTATCAATAATGCTCAGATCAATATAT
ACAATAGGTCTTGGGCCTACATTAATACTTCTTGGTGCAGCTAATCTTTGTAATAAAATT
GTTTTTCTGGTGAGTTTTGTTGGAAATCGTGGCACGTTCACCCGTGGGTACCGAGCAGTC
ATCCTGGATATGGCCTTTCTCTATCACGTGGCGTATGTCCTGGTTTGCATGCTGGGCCTT
TTTGTCCATGAATTCTTCTATAGCTTCCTGCTTTTTGATTTGGTGTACAGGGAAGAGACT
TTGCTGAATGTCATAAAAAGTGTCACACGAAATGGCCGCTCTATTATTCTAACTGCAGTC
CTGGCTCTCATCCTCGTCTACCTGTTTTCCATTATTGGGTTCCTTTTTTTGAAGGATGAC
TTCACTATGGAAGTTGATAGGCTGAAAAACCGAACTCCTGTTACAGGCAGTCATCAAGTG
CCTACTATGACTTTAACTACCATGATGGAAGCATGTGCCAAGGAGAACTGTTCACCCACA
ATTCCAGCTTCAAATACAGCTGATGAAGAGTATGAAGATGGAATTGAAAGGACGTGTGAC
ACTCTCCTTATGTGCATTGTCACCGTGCTGAACCAGGGCCTCAGGAATGGCGGTGGTGTG
GGGGATGTGCTAAGAAGGCCATCGAAAGATGAGCCCTTGTTTGCTGCCCGAGTGGTTTAT
GACCTTCTTTTTTATTTCATTGTTATCATTATTGTTCTGAACTTGATTTTTGGTGTTATC
ATCGATACTTTTGCTGATCTCAGAAGCGAAAAACAGAAAAAAGAAGAAATTCTAAAGACA
ACTTGTTTCATCTGTGGACTTGAGAGAGACAAGTTTGATAATAAAACGGTTTCATTTGAG
GAGCACATTAAGTCAGAACACAATATGTGGCATTATTTGTACTTCATAGTCCTGGTGAAA
GTTAAAGACCCAACAGAATACACTGGACCTGAAAGTTATGTGGCTCAAATGATTGTGGAG
AAGAATTTGGATTGGTTTCCTCGGATGCGAGCCATGTCCCTCGTTAGCAATGAAGGCGAC
AGTGAGCAAAATGAAATTCGGAGCCTTCAGGAGAAGTTGGAATCGACCATGAGTCTGGTC
AAACAGCTGTCGGGTCAGCTGGCGGAGCTCAAGGAGCAGATGACAGAACAAAGGAAGAAT
AAGCAGAGACTGGGCTTCCTCGGATCAAACACACCCCATGTGAATCATCACATGCCACCA
CACTGA
Chromosome Location
12
Locus
12p11.23
External Identifiers
ResourceLink
UniProtKB IDQ14571
UniProtKB Entry NameITPR2_HUMAN
HGNC IDHGNC:6181
General References
  1. Yamamoto-Hino M, Sugiyama T, Hikichi K, Mattei MG, Hasegawa K, Sekine S, Sakurada K, Miyawaki A, Furuichi T, Hasegawa M, et al.: Cloning and characterization of human type 2 and type 3 inositol 1,4,5-trisphosphate receptors. Receptors Channels. 1994;2(1):9-22. [PubMed:8081734]
  2. Futatsugi A, Kuwajima G, Mikoshiba K: Muscle-specific mRNA isoform encodes a protein composed mainly of the N-terminal 175 residues of type 2 Ins(1,4,5)P3 receptor. Biochem J. 1998 Sep 15;334 ( Pt 3):559-63. [PubMed:9729462]
  3. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075]
  4. Yang J, McBride S, Mak DO, Vardi N, Palczewski K, Haeseleer F, Foskett JK: Identification of a family of calcium sensors as protein ligands of inositol trisphosphate receptor Ca(2+) release channels. Proc Natl Acad Sci U S A. 2002 May 28;99(11):7711-6. [PubMed:12032348]
  5. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  6. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  7. Klar J, Hisatsune C, Baig SM, Tariq M, Johansson AC, Rasool M, Malik NA, Ameur A, Sugiura K, Feuk L, Mikoshiba K, Dahl N: Abolished InsP3R2 function inhibits sweat secretion in both humans and mice. J Clin Invest. 2014 Nov;124(11):4773-80. doi: 10.1172/JCI70720. Epub 2014 Oct 20. [PubMed:25329695]
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  9. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [PubMed:23186163]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00201CaffeineapprovedunknowninhibitorDetails