Inter-alpha-trypsin inhibitor heavy chain H4

Details

Name
Inter-alpha-trypsin inhibitor heavy chain H4
Synonyms
  • Gp120
  • IHRP
  • Inter-alpha-trypsin inhibitor family heavy chain-related protein
  • ITI heavy chain H4
  • ITIHL1
  • PK-120
  • PK120
  • Plasma kallikrein sensitive glycoprotein 120
Gene Name
ITIH4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049874|Inter-alpha-trypsin inhibitor heavy chain H4
MKPPRPVRTCSKVLVLLSLLAIHQTTTAEKNGIDIYSLTVDSRVSSRFAHTVVTSRVVNR
ANTVQEATFQMELPKKAFITNFSMIIDGMTYPGIIKEKAEAQAQYSAAVAKGKSAGLVKA
TGRNMEQFQVSVSVAPNAKITFELVYEELLKRRLGVYELLLKVRPQQLVKHLQMDIHIFE
PQGISFLETESTFMTNQLVDALTTWQNKTKAHIRFKPTLSQQQKSPEQQETVLDGNLIIR
YDVDRAISGGSIQIENGYFVHYFAPEGLTTMPKNVVFVIDKSGSMSGRKIQQTREALIKI
LDDLSPRDQFNLIVFSTEATQWRPSLVPASAENVNKARSFAAGIQALGGTNINDAMLMAV
QLLDSSNQEERLPEGSVSLIILLTDGDPTVGETNPRSIQNNVREAVSGRYSLFCLGFGFD
VSYAFLEKLALDNGGLARRIHEDSDSALQLQDFYQEVANPLLTAVTFEYPSNAVEEVTQN
NFRLLFKGSEMVVAGKLQDRGPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPKYIF
HNFMERLWAYLTIQQLLEQTVSASDADQQALRNQALNLSLAYSFVTPLTSMVVTKPDDQE
QSQVAEKPMEGESRNRNVHSGSTFFKYYLQGAKIPKPEASFSPRRGWNRQAGAAGSRMNF
RPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPATSNPDPAVSRVMNMKIEETT
MTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGF
SWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDP
DKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQ
GNDHSATRERRLDYQEGPPGVEISCWSVEL
Number of residues
930
Molecular Weight
103356.645
Theoretical pI
Not Available
GO Classification
Functions
endopeptidase inhibitor activity / serine-type endopeptidase inhibitor activity
Processes
acute-phase response / hyaluronan metabolic process / platelet degranulation / response to cytokine
Components
blood microparticle / extracellular exosome / extracellular region / plasma membrane / platelet dense granule lumen
General Function
Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Specific Function
Endopeptidase inhibitor activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049875|Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4)
ATGAAGCCCCCAAGGCCTGTCCGTACCTGCAGCAAAGTTCTCGTCCTGCTTTCACTGCTG
GCCATCCACCAGACTACTACTGCCGAAAAGAATGGCATCGACATCTACAGCCTCACCGTG
GACTCCAGGGTCTCATCCCGATTTGCCCACACGGTCGTCACCAGCCGAGTGGTCAATAGG
GCCAATACTGTGCAGGAGGCCACCTTCCAGATGGAGCTGCCCAAGAAAGCCTTCATCACC
AACTTCTCCATGATCATCGATGGCATGACCTACCCAGGGATCATCAAGGAGAAGGCTGAA
GCCCAGGCACAGTACAGCGCAGCAGTGGCCAAGGGAAAGAGCGCTGGCCTCGTCAAGGCC
ACCGGGAGAAACATGGAGCAGTTCCAGGTGTCGGTCAGTGTGGCTCCCAATGCCAAGATC
ACCTTTGAGCTGGTCTATGAGGAGCTGCTCAAGCGGCGTTTGGGGGTGTACGAGCTGCTG
CTGAAAGTGCGGCCCCAGCAGCTGGTCAAGCACCTGCAGATGGACATTCACATCTTCGAG
CCCCAGGGCATCAGCTTTCTGGAGACAGAGAGCACCTTCATGACCAACCAGCTGGTAGAC
GCCCTCACCACCTGGCAGAATAAGACCAAGGCTCACATCCGGTTCAAGCCAACACTTTCC
CAGCAGCAAAAGTCCCCAGAGCAGCAAGAAACAGTCCTGGACGGCAACCTCATTATCCGC
TATGATGTGGACCGGGCCATCTCCGGGGGCTCCATTCAGATCGAGAACGGCTACTTTGTA
CACTACTTTGCCCCCGAGGGCCTAACCACAATGCCCAAGAATGTGGTCTTTGTCATTGAC
AAGAGCGGCTCCATGAGTGGCAGGAAAATCCAGCAGACCCGGGAAGCCCTAATCAAGATC
CTGGATGACCTCAGCCCCAGAGACCAGTTCAACCTCATCGTCTTCAGTACAGAAGCAACT
CAGTGGAGGCCATCACTGGTGCCAGCCTCAGCCGAGAACGTGAACAAGGCCAGGAGCTTT
GCTGCGGGCATCCAGGCCCTGGGAGGGACCAACATCAATGATGCAATGCTGATGGCTGTG
CAGTTGCTGGACAGCAGCAACCAGGAGGAGCGGCTGCCCGAAGGGAGTGTCTCACTCATC
ATCCTGCTCACCGATGGCGACCCCACTGTGGGGGAGACTAACCCCAGGAGCATCCAGAAT
AACGTGCGGGAAGCTGTAAGTGGCCGGTACAGCCTCTTCTGCCTGGGCTTCGGTTTCGAC
GTCAGCTATGCCTTCCTGGAGAAGCTGGCACTGGACAATGGCGGCCTGGCCCGGCGCATC
CATGAGGACTCAGACTCTGCCCTGCAGCTCCAGGACTTCTACCAGGAAGTGGCCAACCCA
CTGCTGACAGCAGTGACCTTCGAGTACCCAAGCAATGCCGTGGAGGAGGTCACTCAGAAC
AACTTCCGGCTCCTCTTCAAGGGCTCAGAGATGGTGGTGGCTGGGAAGCTCCAGGACCGG
GGGCCTGATGTGCTCACAGCCACAGTCAGTGGGAAGCTGCCTACACAGAACATCACTTTC
CAAACGGAGTCCAGTGTGGCAGAGCAGGAGGCGGAGTTCCAGAGCCCCAAGTATATCTTC
CACAACTTCATGGAGAGGCTCTGGGCATACCTGACTATCCAGCAGCTGCTGGAGCAAACT
GTCTCCGCATCCGATGCTGATCAGCAGGCCCTCCGGAACCAAGCGCTGAATTTATCACTT
GCCTACAGCTTTGTCACGCCTCTCACATCTATGGTAGTCACCAAACCCGATGACCAAGAG
CAGTCTCAAGTTGCTGAGAAGCCCATGGAAGGCGAAAGTAGAAACAGGAATGTCCACTCA
GGTTCCACTTTCTTCAAATATTATCTCCAGGGAGCAAAAATACCAAAACCAGAGGCTTCC
TTTTCTCCAAGAAGAGGATGGAATAGACAAGCTGGAGCTGCTGGCTCCCGGATGAATTTC
AGACCTGGGGTTCTCAGCTCCAGGCAACTTGGACTCCCAGGACCTCCTGATGTTCCTGAC
CATGCTGCTTACCACCCCTTCCGCCGTCTGGCCATCTTGCCTGCTTCAGCACCACCAGCC
ACCTCAAATCCTGATCCAGCTGTGTCTCGTGTCATGAATATGAAAATCGAAGAAACAACC
ATGACAACCCAAACCCCAGCCCCCATACAGGCTCCCTCTGCCATCCTGCCACTGCCTGGG
CAGAGTGTGGAGCGGCTCTGTGTGGACCCCAGACACCGCCAGGGGCCAGTGAACCTGCTC
TCAGACCCTGAGCAAGGGGTTGAGGTGACTGGCCAGTATGAGAGGGAGAAGGCTGGGTTC
TCATGGATCGAAGTGACCTTCAAGAACCCCCTGGTATGGGTTCACGCATCCCCTGAACAC
GTGGTGGTGACTCGGAACCGAAGAAGCTCTGCGTACAAGTGGAAGGAGACGCTATTCTCA
GTGATGCCCGGCCTGAAGATGACCATGGACAAGACGGGTCTCCTGCTGCTCAGTGACCCA
GACAAAGTGACCATCGGCCTGTTGTTCTGGGATGGCCGTGGGGAGGGGCTCCGGCTCCTT
CTGCGTGACACTGACCGCTTCTCCAGCCACGTTGGAGGGACCCTTGGCCAGTTTTACCAG
GAGGTGCTCTGGGGATCTCCAGCAGCATCAGATGACGGCAGACGCACGCTGAGGGTTCAG
GGCAATGACCACTCTGCCACCAGAGAGCGCAGGCTGGATTACCAGGAGGGGCCCCCGGGA
GTGGAGATTTCCTGCTGGTCTGTGGAGCTGTAG
Chromosome Location
3
Locus
3p21.1
External Identifiers
ResourceLink
UniProtKB IDQ14624
UniProtKB Entry NameITIH4_HUMAN
HGNC IDHGNC:6169
General References
  1. Nishimura H, Kakizaki I, Muta T, Sasaki N, Pu PX, Yamashita T, Nagasawa S: cDNA and deduced amino acid sequence of human PK-120, a plasma kallikrein-sensitive glycoprotein. FEBS Lett. 1995 Jan 3;357(2):207-11. [PubMed:7805892]
  2. Saguchi K, Tobe T, Hashimoto K, Sano Y, Nakano Y, Miura NH, Tomita M: Cloning and characterization of cDNA for inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP), a novel human plasma glycoprotein. J Biochem. 1995 Jan;117(1):14-8. [PubMed:7775381]
  3. Saguchi K, Tobe T, Hashimoto K, Nagasaki Y, Oda E, Nakano Y, Miura NH, Tomita M: Isolation and characterization of the human inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene (ITIHL1). J Biochem. 1996 May;119(5):898-905. [PubMed:8797089]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Kroczynska B, King-Simmons L, Alloza L, Alava MA, Elguindi EC, Blond SY: BIP co-chaperone MTJ1/ERDJ1 interacts with inter-alpha-trypsin inhibitor heavy chain 4. Biochem Biophys Res Commun. 2005 Dec 23;338(3):1467-77. Epub 2005 Oct 26. [PubMed:16271702]
  6. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  7. Choi-Miura NH, Sano Y, Oda E, Nakano Y, Tobe T, Yanagishita T, Taniyama M, Katagiri T, Tomita M: Purification and characterization of a novel glycoprotein which has significant homology to heavy chains of inter-alpha-trypsin inhibitor family from human plasma. J Biochem. 1995 Feb;117(2):400-7. [PubMed:7541790]
  8. Pu XP, Iwamoto A, Nishimura H, Nagasawa S: Purification and characterization of a novel substrate for plasma kallikrein (PK-120) in human plasma. Biochim Biophys Acta. 1994 Oct 19;1208(2):338-43. [PubMed:7947966]
  9. Pineiro M, Alava MA, Gonzalez-Ramon N, Osada J, Lasierra P, Larrad L, Pineiro A, Lampreave F: ITIH4 serum concentration increases during acute-phase processes in human patients and is up-regulated by interleukin-6 in hepatocarcinoma HepG2 cells. Biochem Biophys Res Commun. 1999 Sep 16;263(1):224-9. [PubMed:10486281]
  10. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519]
  11. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [PubMed:14760718]
  12. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  13. Kashyap RS, Nayak AR, Deshpande PS, Kabra D, Purohit HJ, Taori GM, Daginawala HF: Inter-alpha-trypsin inhibitor heavy chain 4 is a novel marker of acute ischemic stroke. Clin Chim Acta. 2009 Apr;402(1-2):160-3. [PubMed:19263524]
  14. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  15. van den Broek I, Sparidans RW, van Winden AW, Gast MC, van Dulken EJ, Schellens JH, Beijnen JH: The absolute quantification of eight inter-alpha-trypsin inhibitor heavy chain 4 (ITIH4)-derived peptides in serum from breast cancer patients. Proteomics Clin Appl. 2010 Dec;4(12):931-9. doi: 10.1002/prca.201000035. [PubMed:21137033]
  16. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  17. Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. [PubMed:22171320]
  18. Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R: Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4. J Proteome Res. 2014 Jul 3;13(7):3314-29. doi: 10.1021/pr500394z. Epub 2014 Jun 12. [PubMed:24884609]
  19. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  20. Tozaki T, Choi-Miura NH, Taniyama M, Kurosawa M, Tomita M: SNP analysis of the inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene by a fluorescence-adapted SSCP method. BMC Med Genet. 2002 Jul 29;3:6. Epub 2002 Jul 29. [PubMed:12147176]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails