Glutamate receptor ionotropic, NMDA 2C

Details

Name
Glutamate receptor ionotropic, NMDA 2C
Synonyms
  • GluN2C
  • Glutamate [NMDA] receptor subunit epsilon-3
  • N-methyl D-aspartate receptor subtype 2C
  • NMDAR2C
  • NR2C
Gene Name
GRIN2C
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010317|Glutamate receptor ionotropic, NMDA 2C
MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPL
EIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASHVSWRLLDVVTLELGPGGPRARTQRLLRQLDAPVFVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPATFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HSYWRQHGTLPAPAGDCRVHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWEHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKSGGPAFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQF
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVY
WKLRHSVPNSSQLDFLLAFSRGIYSCFSGVQSLASPPRQASPDLTASSAQASVLKMLQAA
RDMVTTAGVSSSLDRATRTIENWGGGRRAPPPSPCPTPRSGPSPCLPTPDPPPEPSPTGW
GPPDGGRAALVRRAPQPPGRPPTPGPPLSDVSRVSRRPAWEARWPVRTGHCGRHLSASER
PLSPARCHYSSFPRADRSGRPFLPLFPELEDLPLLGPEQLARREALLHAAWARGSRPRHA
SLPSSVAEAFARPSSLPAGCTGPACARPDGHSACRRLAQAQSMCLPIYREACQEGEQAGA
PAWQHRQHVCLHAHAHLPFCWGAVCPHLPPCASHGSWLSGAWGPLGHRGRTLGLGTGYRD
SGGLDEISRVARGTQGFPGPCTWRRISSLESEV
Number of residues
1233
Molecular Weight
134207.77
Theoretical pI
8.61
GO Classification
Functions
cation channel activity / extracellular-glutamate-gated ion channel activity / NMDA glutamate receptor activity
Processes
activation of MAPKK activity / axon guidance / directional locomotion / epidermal growth factor receptor signaling pathway / excitatory postsynaptic potential / Fc-epsilon receptor signaling pathway / fibroblast growth factor receptor signaling pathway / glutamate receptor signaling pathway / innate immune response / insulin receptor signaling pathway / ion transmembrane transport / ionotropic glutamate receptor signaling pathway / MAPK cascade / negative regulation of protein catabolic process / neuromuscular process controlling balance / neurotrophin TRK receptor signaling pathway / protein localization / Ras protein signal transduction / response to wounding / small GTPase mediated signal transduction / synaptic transmission / synaptic transmission, glutamatergic / transport / vascular endothelial growth factor receptor signaling pathway
Components
cell junction / dendrite / integral component of plasma membrane / intracellular / NMDA selective glutamate receptor complex / plasma membrane / postsynaptic density / postsynaptic membrane
General Function
Nmda glutamate receptor activity
Specific Function
NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine.
Pfam Domain Function
Transmembrane Regions
554-574 627-647 815-835
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010318|Glutamate receptor ionotropic, NMDA 2C (GRIN2C)
ATGGGTGGGGCCCTGGGGCCGGCCCTGTTGCTCACCTCGCTCTTCGGTGCCTGGGCAGGG
CTGGGTCCGGGGCAGGGCGAGCAGGGCATGACGGTGGCCGTGGTGTTTAGCAGCTCAGGG
CCGCCCCAGGCCCAGTTCCGTGCCCGCCTCACCCCCCAGAGCTTCCTGGACCTACCCCTG
GAGATCCAGCCGCTCACAGTTGGGGTCAACACCACCAACCCCAGCAGCCTCCTCACCCAG
ATCTGCGGCCTCCTGGGTGCTGCCCACGTCCACGGCATTGTCTTTGAGGACAACGTGGAC
ACCGAGGCGGTGGCCCAGATCCTTGACTTCATCTCCTCCCAGACCCATGTGCCCATCCTC
AGCATCAGCGGAGGCTCTGCTGTGGTCCTCACCCCCAAGGAGCCGGGCTCCGCCTTCCTG
CAGCTGGGCGTGTCCCTGGAGCAGCAGCTGCAGGTGCTGTTCAAGGTGCTGGAAGAGTAC
GACTGGAGCGCCTTCGCCGTCATCACCAGCCTGCACCCGGGCCACGCGCTCTTCCTGGAG
GGCGTGCGCGCCGTCGCCGACGCCAGCCACGTGAGTTGGCGGCTGCTGGACGTGGTCACG
CTGGAGCTGGGCCCGGGAGGGCCGCGCGCGCGCACGCAGCGCCTGCTGCGCCAGCTCGAC
GCGCCCGTGTTTGTGGCCTACTGCTCGCGCGAGGAGGCCGAGGTGCTCTTCGCCGAGGCG
GCGCAGGCCGGTCTGGTGGGGCCCGGCCACGTGTGGCTGGTGCCCAACCTGGCGCTGGGC
AGCACCGATGCGCCCCCCGCCACCTTCCCCGTGGGCCTCATCAGCGTCGTCACCGAGAGC
TGGCGCCTCAGCCTGCGCCAGAAGGTGCGCGACGGCGTGGCCATTCTGGCCCTGGGCGCC
CACAGCTACTGGCGCCAGCATGGAACCCTGCCAGCCCCGGCCGGGGACTGCCGTGTTCAC
CCTGGGCCCGTCAGCCCTGCCCGGGAGGCCTTCTACAGGCACCTACTGAATGTCACCTGG
GAGGGCCGAGACTTCTCCTTCAGCCCTGGTGGGTACCTGGTCCAGCCCACCATGGTGGTG
ATCGCCCTCAACCGGCACCGCCTCTGGGAGATGGTGGGGCGCTGGGAGCATGGCGTCCTA
TACATGAAGTACCCCGTGTGGCCTCGCTACAGTGCCTCTCTGCAGCCTGTGGTGGACAGT
CGGCACCTGACGGTGGCCACGCTGGAAGAGCGGCCCTTTGTCATCGTGGAGAGCCCTGAC
CCTGGCACAGGAGGCTGTGTCCCCAACACCGTGCCCTGCCGCAGGCAGAGCAACCACACC
TTCAGCAGCGGGGACGTGGCCCCCTACACCAAGCTCTGCTGTAAGGGATTCTGCATCGAC
ATCCTCAAGAAGCTGGCCAGAGTGGTCAAATTCTCCTACGACCTGTACCTGGTGACCAAC
GGCAAGCATGGCAAGCGGGTGCGCGGCGTATGGAACGGCATGATTGGGGAGGTGTACTAC
AAGCGGGCAGACATGGCCATCGGCTCCCTCACCATCAATGAGGAACGCTCCGAGATCGTA
GACTTCTCTGTACCCTTTGTGGAGACGGGCATCAGTGTGATGGTGGCTCGCAGCAATGGC
ACCGTCTCCCCCTCGGCCTTCTTGGAGCCATATAGCCCTGCAGTGTGGGTGATGATGTTT
GTCATGTGCCTCACTGTGGTGGCCATCACCGTCTTCATGTTCGAGTACTTCAGCCCTGTC
AGCTACAACCAGAACCTCACCAGAGGCAAGAAGTCCGGGGGCCCAGCTTTCACTATCGGC
AAGTCCGTGTGGCTGCTGTGGGCGCTGGTCTTCAACAACTCAGTGCCCATCGAGAACCCG
CGGGGCACCACCAGCAAGATCATGGTTCTGGTCTGGGCCTTCTTTGCTGTCATCTTCCTC
GCCAGCTACACGGCCAACCTGGCCGCCTTCATGATCCAAGAGCAATACATCGACACTGTG
TCGGGCCTCAGTGACAAGAAGTTTCAGCGGCCTCAAGATCAGTACCCACCTTTCCGCTTC
GGCACGGTGCCCAACGGCAGCACGGAGCGGAACATCCGCAGTAACTACCGTGACATGCAC
ACCCACATGGTCAAGTTCAACCAGCGCTCGGTGGAGGACGCGCTCACCAGCCTCAAGATG
GGGAAGCTGGATGCCTTCATCTATGATGCTGCTGTCCTCAACTACATGGCAGGCAAGGAC
GAGGGCTGCAAGCTGGTCACCATTGGGTCTGGCAAGGTCTTTGCTACCACTGGCTACGGC
ATCGCCATGCAGAAGGACTCCCACTGGAAGCGGGCCATAGACCTGGCGCTCTTGCAGTTC
CTGGGGGACGGAGAGACACAGAAACTGGAGACAGTGTGGCTCTCAGGGATCTGCCAGAAT
GAGAAGAACGAGGTGATGAGCAGCAAGCTGGACATCGACAACATGGCAGGCGTCTTCTAC
ATGCTGCTGGTGGCCATGGGGCTGGCCCTGCTGGTCTTCGCCTGGGAGCACCTGGTCTAC
TGGAAGCTGCGCCACTCGGTGCCCAACTCATCCCAGCTGGACTTCCTGCTGGCTTTCAGC
AGGGGCATCTACAGCTGCTTCAGCGGGGTGCAGAGCCTCGCCAGCCCACCGCGGCAGGCC
AGCCCGGACCTCACGGCCAGCTCGGCCCAGGCCAGCGTGCTCAAGATGCTGCAGGCAGCC
CGCGACATGGTGACCACGGCGGGCGTAAGCAGCTCCCTGGACCGCGCCACTCGCACCATC
GAGAATTGGGGTGGCGGCCGCCGTGCGCCCCCACCGTCCCCCTGCCCGACCCCGCGGTCT
GGCCCCAGCCCATGCCTGCCCACCCCCGACCCGCCCCCAGAGCCGAGCCCCACGGGCTGG
GGACCGCCAGACGGGGGTCGCGCGGCGCTTGTGCGCAGGGCTCCGCAGCCCCCGGGCCGC
CCCCCGACGCCGGGGCCGCCCCTGTCCGACGTCTCCCGAGTGTCGCGCCGCCCAGCCTGG
GAGGCGCGGTGGCCGGTGCGGACCGGGCACTGCGGGAGGCACCTCTCGGCCTCCGAGCGG
CCCCTGTCGCCCGCGCGCTGTCACTACAGCTCCTTTCCTCGAGCCGACCGATCCGGCCGC
CCCTTCCTCCCGCTCTTCCCGGAGCTGGAGGACCTGCCGCTGCTCGGTCCGGAGCAGCTG
GCCCGGCGGGAGGCCCTGCTGCACGCGGCCTGGGCCCGGGGCTCGCGCCCGCGTCACGCT
TCCCTGCCCAGCTCCGTGGCCGAGGCCTTCGCTCGGCCCAGCTCGCTGCCCGCTGGGTGC
ACCGGCCCCGCCTGCGCCCGCCCCGACGGCCACTCGGCCTGCAGGCGCTTGGCGCAGGCG
CAGTCGATGTGCTTGCCGATCTACCGGGAGGCCTGCCAGGAGGGCGAGCAGGCAGGGGCC
CCCGCCTGGCAGCACAGACAGCACGTCTGCCTGCACGCCCACGCCCACCTGCCATTTTGC
TGGGGGGCTGTCTGTCCTCACCTTCCACCCTGTGCCAGCCACGGCTCCTGGCTCTCCGGG
GCCTGGGGGCCTCTGGGGCACAGGGGCAGGACTCTGGGGCTGGGCACAGGCTACAGAGAC
AGTGGGGGACTGGACGAGATCAGCAGGGTAGCCCGTGGGACGCAAGGCTTCCCGGGACCC
TGCACCTGGAGACGGATCTCCAGTCTGGAGTCAGAAGTGTGA
Chromosome Location
17
Locus
17q25
External Identifiers
ResourceLink
UniProtKB IDQ14957
UniProtKB Entry NameNMDE3_HUMAN
GenBank Protein ID1196449
GenBank Gene IDL76224
GenAtlas IDGRIN2C
HGNC IDHGNC:4587
General References
  1. Lin YJ, Bovetto S, Carver JM, Giordano T: Cloning of the cDNA for the human NMDA receptor NR2C subunit and its expression in the central nervous system and periphery. Brain Res Mol Brain Res. 1996 Dec 31;43(1-2):57-64. [PubMed:9037519]
  2. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Cai L, Loo LS, Atlashkin V, Hanson BJ, Hong W: Deficiency of sorting nexin 27 (SNX27) leads to growth retardation and elevated levels of N-methyl-D-aspartate receptor 2C (NR2C). Mol Cell Biol. 2011 Apr;31(8):1734-47. doi: 10.1128/MCB.01044-10. Epub 2011 Feb 7. [PubMed:21300787]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00142Glutamic Acidapproved, nutraceuticalunknownDetails
DB00145Glycineapproved, nutraceutical, vet_approvedunknownDetails
DB01520Tenocyclidineexperimental, illicit, investigationalyesantagonistDetails
DB00454MeperidineapprovedunknownantagonistDetails
DB00659Acamprosateapproved, investigationalyesantagonistDetails
DB06741GavestinelinvestigationalunknownantagonistDetails
DB09481Magnesium carbonateapproved, investigationalunknownblockerDetails
DB09409Magnesium acetate tetrahydrateapprovedunknownligandDetails
DB13146Fluciclovine (18F)approvednoinhibitorDetails
DB04896Milnacipranapproved, investigationalunknowninhibitorDetails
DB00289AtomoxetineapprovedunknownblockerDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedunknownantagonistDetails
DB00418Secobarbitalapproved, vet_approvedunknownantagonistDetails
DB00996Gabapentinapproved, investigationalunknowninhibitorDetails
DB01174Phenobarbitalapproved, investigationalunknownantagonistDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownagonistDetails
DB06738KetobemidoneexperimentalunknownantagonistDetails