Pregnancy-specific beta-1-glycoprotein 5

Details

Name
Pregnancy-specific beta-1-glycoprotein 5
Synonyms
  • Fetal liver non-specific cross-reactive antigen 3
  • FL-NCA-3
  • PS-beta-G-5
Gene Name
PSG5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049706|Pregnancy-specific beta-1-glycoprotein 5
MGPLSAPPCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQ
NLAGYIWYKGQLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY
TLHIIKRGDRTRGVTGYFTFNLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIW
WLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYECEIRDRDGGMRSDPVTLNVLYGPD
LPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQQSGQKLSIPQITTKHRGLYT
CSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI
Number of residues
335
Molecular Weight
37712.79
Theoretical pI
Not Available
GO Classification
Processes
female pregnancy
Components
extracellular region
General Function
Not Available
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049707|Pregnancy-specific beta-1-glycoprotein 5 (PSG5)
ATGGGGCCCCTCTCAGCCCCTCCCTGCACACAGCACATCACCTGGAAGGGGCTCCTGCTC
ACAGCATCACTTTTAAACTTCTGGAACCTGCCTATCACTGCTCAAGTCACGATTGAAGCC
CTGCCACCCAAAGTTTCCGAGGGGAAGGATGTTCTTCTACTTGTCCACAATTTGCCTCAG
AATCTTGCTGGCTACATCTGGTACAAAGGACAACTGATGGACCTCTACCATTACATTACA
TCATATGTAGTAGACGGTCAAATAAATATATATGGGCCTGCATACACTGGACGAGAAACA
GTATATTCCAATGCATCCCTGCTGATCCAGAATGTCACCCGGGAAGACGCAGGATCCTAC
ACCTTACACATCATAAAGCGAGGTGATAGGACTAGAGGAGTAACTGGATATTTCACCTTC
AACTTATACCTGAAGCTGCCCAAGCCCTACATCACCATCAACAACTCAAAACCCAGGGAG
AATAAGGATGTCTTAGCCTTCACCTGTGAACCTAAGAGTGAGAACTACACCTACATTTGG
TGGCTAAATGGTCAGAGCCTCCCGGTCAGTCCCAGGGTAAAGCGACCCATTGAAAACAGG
ATCCTCATTCTACCCAGTGTCACGAGAAATGAAACAGGACCCTATGAATGTGAAATACGG
GACCGAGATGGTGGCATGCGCAGTGACCCAGTCACCCTGAATGTCCTCTATGGTCCAGAC
CTCCCCAGCATTTACCCTTCATTCACCTATTACCGTTCAGGAGAAAACCTCTACTTGTCC
TGCTTCGCGGAATCTAACCCACCGGCAGAGTATTTTTGGACAATTAATGGGAAGTTTCAG
CAATCAGGACAAAAGCTCTCTATCCCCCAAATTACTACAAAGCATAGAGGGCTCTATACT
TGCTCTGTTCGTAACTCAGCTACTGGCAAGGAAAGCTCCAAATCCATGACAGTCGAAGTC
TCTGCTCCTTCAGGAATAGGACGTCTTCCTCTCCTTAATCCAATATAG
Chromosome Location
19
Locus
19q13.31
External Identifiers
ResourceLink
UniProtKB IDQ15238
UniProtKB Entry NamePSG5_HUMAN
HGNC IDHGNC:9522
General References
  1. Oikawa S, Inuzuka C, Kuroki M, Matsuoka Y, Kosaki G, Nakazato H: A pregnancy-specific beta 1-glycoprotein, a CEA gene family member, expressed in a human promyelocytic leukemia cell line, HL-60: structures of protein, mRNA and gene. Biochem Biophys Res Commun. 1989 Sep 15;163(2):1021-31. [PubMed:2789512]
  2. Chan WY, Zheng QX, McMahon J, Tease LA: Characterization of new members of the pregnancy-specific beta 1-glycoprotein family. Mol Cell Biochem. 1991 Aug 14;106(2):161-70. [PubMed:1922019]
  3. Khan WN, Hammarstrom S: Carcinoembryonic antigen gene family: molecular cloning of cDNA for a PS beta G/FL-NCA glycoprotein with a novel domain arrangement. Biochem Biophys Res Commun. 1989 Jun 15;161(2):525-35. [PubMed:2735907]
  4. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00523Alitretinoinapproved, investigationalunknownDetails