Nuclear receptor coactivator 2

Details

Name
Nuclear receptor coactivator 2
Synonyms
  • BHLHE75
  • Class E basic helix-loop-helix protein 75
  • hTIF2
  • NCoA-2
  • SRC2
  • TIF2
  • Transcriptional intermediary factor 2
Gene Name
NCOA2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012608|Nuclear receptor coactivator 2
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI
VNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLS
SNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPG
QPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA
ESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASS
LSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESS
STAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
LIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAII
NDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAG
PFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSA
VRVTCAATTSAMNRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGG
PQYSQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALL
DQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQ
AQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQ
QNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQ
RTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATT
PQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQAN
TSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGG
NLFPNQLPGMDMIKQEGDTTRKYC
Number of residues
1464
Molecular Weight
159155.645
Theoretical pI
6.62
GO Classification
Functions
chromatin binding / histone acetyltransferase activity / ligand-dependent nuclear receptor binding / ligand-dependent nuclear receptor transcription coactivator activity / nuclear hormone receptor binding / RNA polymerase II core promoter proximal region sequence-specific DNA binding / RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding / thyroid hormone receptor coactivator activity / transcription coactivator activity
Processes
bile acid and bile salt transport / bile acid metabolic process / cellular lipid metabolic process / cellular response to hormone stimulus / cellular response to Thyroglobulin triiodothyronine / chromatin organization / circadian regulation of gene expression / intracellular receptor signaling pathway / locomotor rhythm / negative regulation of transcription from RNA polymerase II promoter / positive regulation of transcription from RNA polymerase II promoter / regulation of glucose metabolic process / regulation of transcription, DNA-templated / small GTPase mediated signal transduction / small molecule metabolic process / transcription, DNA-templated
Components
cytoplasm / nucleoplasm / nucleus
General Function
Transcription coactivator activity
Specific Function
Transcriptional coactivator for steroid receptors and nuclear receptors. Coactivator of the steroid binding domain (AF-2) but not of the modulating N-terminal domain (AF-1). Required with NCOA1 to control energy balance between white and brown adipose tissues. Critical regulator of glucose metabolism regulation, acts as RORA coactivator to specifically modulate G6PC expression. Involved in the positive regulation of the transcriptional activity of the glucocorticoid receptor NR3C1 by sumoylation enhancer RWDD3. Positively regulates the circadian clock by acting as a transcriptional coactivator for the CLOCK-ARNTL/BMAL1 heterodimer (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0012609|Nuclear receptor coactivator 2 (NCOA2)
ATGAGTGGGATGGGAGAAAATACCTCTGACCCCTCCAGGGCAGAGACAAGAAAGCGCAAG
GAATGTCCTGACCAACTTGGACCCAGCCCCAAAAGGAACACTGAAAAACGTAATCGTGAA
CAGGAAAATAAATATATAGAAGAACTTGCAGAGTTGATTTTTGCAAATTTTAATGATATA
GACAACTTTAACTTCAAACCTGACAAATGTGCAATCTTAAAAGAAACTGTGAAGCAAATT
CGTCAGATCAAAGAACAAGAGAAAGCAGCAGCTGCCAACATAGATGAAGTGCAGAAGTCA
GATGTATCCTCTACAGGGCAGGGTGTCATCGACAAGGATGCGCTGGGGCCTATGATGCTT
GAGGCCCTTGATGGGTTCTTCTTTGTAGTGAACCTGGAAGGCAACGTTGTGTTTGTGTCA
GAGAATGTGACACAGTATCTAAGGTATAACCAAGAAGAGCTGATGAACAAAAGTGTATAT
AGCATCTTGCATGTTGGGGACCACACGGAATTTGTCAAAAACCTGCTGCCAAAGTCTATA
GTAAATGGGGGATCTTGGTCTGGCGAACCTCCGAGGCGGAACAGCCATACCTTCAATTGT
CGGATGCTGGTAAAACCTTTACCTGATTCAGAAGAGGAGGGTCATGATAACCAGGAAGCT
CATCAGAAATATGAAACTATGCAGTGCTTCGCTGTCTCTCAACCAAAGTCCATCAAAGAA
GAAGGAGAAGATTTGCAGTCCTGCTTGATTTGCGTGGCAAGAAGAGTTCCCATGAAGGAA
AGACCAGTTCTTCCCTCATCAGAAAGTTTTACTACTCGCCAGGATCTCCAAGGCAAGATC
ACGTCTCTGGATACCAGCACCATGAGAGCAGCCATGAAACCAGGCTGGGAGGACCTGGTA
AGAAGGTGTATTCAGAAGTTCCATGCGCAGCATGAAGGAGAATCTGTGTCCTATGCTAAG
AGGCATCATCATGAAGTACTGAGACAAGGATTGGCATTCAGTCAAATCTATCGTTTTTCC
TTGTCTGATGGCACTCTTGTTGCTGCACAAACGAAGAGCAAACTCATCCGTTCTCAGACT
ACTAATGAACCTCAACTTGTAATATCTTTACATATGCTTCACAGAGAGCAGAATGTGTGT
GTGATGAATCCGGATCTGACTGGACAAACGATGGGGAAGCCACTGAATCCAATTAGCTCT
AACAGCCCTGCCCATCAGGCCCTGTGCAGTGGGAACCCAGGTCAGGACATGACCCTCAGT
AGCAATATAAATTTTCCCATAAATGGCCCAAAGGAACAAATGGGCATGCCCATGGGCAGG
TTTGGTGGTTCTGGGGGAATGAACCATGTGTCAGGCATGCAAGCAACCACTCCTCAGGGT
AGTAACTATGCACTCAAAATGAACAGCCCCTCACAAAGCAGCCCTGGCATGAATCCAGGA
CAGCCCACCTCCATGCTTTCACCAAGGCATCGCATGAGCCCTGGAGTGGCTGGCAGCCCT
CGAATCCCACCCAGTCAGTTTTCCCCTGCAGGAAGCTTGCATTCCCCTGTGGGAGTTTGC
AGCAGCACAGGAAATAGCCATAGTTATACCAACAGCTCCCTCAATGCACTTCAGGCCCTC
AGCGAGGGGCACGGGGTCTCATTAGGGTCATCGTTGGCTTCACCAGACCTAAAAATGGGC
AATTTGCAAAACTCCCCAGTTAATATGAATCCTCCCCCACTCAGCAAGATGGGAAGCTTG
GACTCAAAAGACTGTTTTGGACTATATGGGGAGCCCTCTGAAGGTACAACTGGACAAGCA
GAGAGCAGCTGCCATCCTGGAGAGCAAAAGGAAACAAATGACCCCAACCTGCCCCCGGCC
GTGAGCAGTGAGAGAGCTGACGGGCAGAGCAGACTGCATGACAGCAAAGGGCAGACCAAA
CTCCTGCAGCTGCTGACCACCAAATCTGATCAGATGGAGCCCTCGCCCTTAGCCAGCTCT
TTGTCGGATACAAACAAAGACTCCACAGGTAGCTTGCCTGGTTCTGGGTCTACACATGGA
ACCTCGCTCAAGGAGAAGCATAAAATTTTGCACAGACTCTTGCAGGACAGCAGTTCCCCT
GTGGACTTGGCCAAGTTAACAGCAGAAGCCACAGGCAAAGACCTGAGCCAGGAGTCCAGC
AGCACAGCTCCTGGATCAGAAGTGACTATTAAACAAGAGCCGGTGAGCCCCAAGAAGAAA
GAGAATGCACTACTTCGCTATTTGCTAGATAAAGATGATACTAAAGATATTGGTTTACCA
GAAATAACCCCCAAACTTGAGAGACTGGACAGTAAGACAGATCCTGCCAGTAACACAAAA
TTAATAGCAATGAAAACTGAGAAGGAGGAGATGAGCTTTGAGCCTGGTGACCAGCCTGGC
AGTGAGCTGGACAACTTGGAGGAGATTTTGGATGATTTGCAGAATAGTCAATTACCACAG
CTTTTCCCAGACACGAGGCCAGGCGCCCCTGCTGGATCAGTTGACAAGCAAGCCATCATC
AATGACCTCATGCAACTCACAGCTGAAAACAGCCCTGTCACACCTGTTGGAGCCCAGAAA
ACAGCACTGCGAATTTCACAGAGCACTTTTAATAACCCACGACCAGGGCAACTGGGCAGG
TTATTGCCAAACCAGAATTTACCACTTGACATCACATTGCAAAGCCCAACTGGTGCTGGA
CCTTTCCCACCAATCAGAAACAGTAGTCCCTACTCAGTGATACCTCAGCCAGGAATGATG
GGTAATCAAGGGATGATAGGAAACCAAGGAAATTTAGGGAACAGTAGCACAGGAATGATT
GGTAACAGTGCTTCTCGGCCTACTATGCCATCTGGAGAATGGGCACCGCAGAGTTCGGCT
GTGAGAGTCACCTGTGCTGCTACCACCAGTGCCATGAACCGGCCAGTCCAAGGAGGTATG
ATTCGGAACCCAGCAGCCAGCATCCCCATGAGGCCCAGCAGCCAGCCTGGCCAAAGACAG
ACGCTTCAGTCTCAGGTCATGAATATAGGGCCATCTGAATTAGAGATGAACATGGGGGGA
CCTCAGTATAGCCAACAACAAGCTCCTCCAAATCAGACTGCCCCATGGCCTGAAAGCATC
CTGCCTATAGACCAGGCGTCTTTTGCCAGCCAAAACAGGCAGCCATTTGGCAGTTCTCCA
GATGACTTGCTATGTCCACATCCTGCAGCTGAGTCTCCGAGTGATGAGGGAGCTCTCCTG
GACCAGCTGTATCTGGCCTTGCGGAATTTTGATGGCCTGGAGGAGATTGATAGAGCCTTA
GGAATACCCGAACTGGTCAGCCAGAGCCAAGCAGTAGATCCAGAACAGTTCTCAAGTCAG
GATTCCAACATCATGCTGGAGCAGAAGGCGCCCGTTTTCCCACAGCAGTATGCATCTCAG
GCACAAATGGCCCAGGGTAGCTATTCTCCCATGCAAGATCCAAACTTTCACACCATGGGA
CAGCGGCCTAGTTATGCCACACTCCGTATGCAGCCCAGACCGGGCCTCAGGCCCACGGGC
CTAGTGCAGAACCAGCCAAATCAACTAAGACTTCAACTTCAGCATCGCCTCCAAGCACAG
CAGAATCGCCAGCCACTTATGAATCAAATCAGCAATGTTTCCAATGTGAACTTGACTCTG
AGGCCTGGAGTACCAACACAGGCACCTATTAATGCACAGATGCTGGCCCAGAGACAGAGG
GAAATCCTGAACCAGCATCTTCGACAGAGACAAATGCATCAGCAACAGCAAGTTCAGCAA
CGAACTTTGATGATGAGAGGACAAGGGTTGAATATGACACCAAGCATGGTGGCTCCTAGT
GGTATGCCAGCAACTATGAGCAACCCTCGGATTCCCCAGGCAAATGCACAGCAGTTTCCA
TTTCCTCCAAACTACGGAATAAGTCAGCAACCTGATCCAGGCTTTACTGGGGCTACGACT
CCCCAGAGCCCACTTATGTCACCCCGAATGGCACATACACAGAGTCCCATGATGCAACAG
TCTCAGGCCAACCCAGCCTATCAGGCCCCCTCCGACATAAATGGATGGGCGCAGGGGAAC
ATGGGCGGAAACAGCATGTTTTCCCAGCAGTCCCCACCACACTTTGGGCAGCAAGCAAAC
ACCAGCATGTACAGTAACAACATGAACATCAATGTGTCCATGGCGACCAACACAGGTGGC
ATGAGCAGCATGAACCAGATGACAGGACAGATCAGCATGACCTCAGTGACCTCCGTGCCT
ACGTCAGGGCTGTCCTCCATGGGTCCCGAGCAGGTTAATGATCCTGCTCTGAGGGGAGGC
AACCTGTTCCCAAACCAGCTGCCTGGAATGGATATGATTAAGCAGGAGGGAGACACAACA
CGGAAATATTGCTGA
Chromosome Location
8
Locus
8q13.3
External Identifiers
ResourceLink
UniProtKB IDQ15596
UniProtKB Entry NameNCOA2_HUMAN
GenBank Protein ID1877215
GenBank Gene IDX97674
HGNC IDHGNC:7669
General References
  1. Voegel JJ, Heine MJ, Zechel C, Chambon P, Gronemeyer H: TIF2, a 160 kDa transcriptional mediator for the ligand-dependent activation function AF-2 of nuclear receptors. EMBO J. 1996 Jul 15;15(14):3667-75. [PubMed:8670870]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Carapeti M, Aguiar RC, Goldman JM, Cross NC: A novel fusion between MOZ and the nuclear receptor coactivator TIF2 in acute myeloid leukemia. Blood. 1998 May 1;91(9):3127-33. [PubMed:9558366]
  4. Voegel JJ, Heine MJ, Tini M, Vivat V, Chambon P, Gronemeyer H: The coactivator TIF2 contains three nuclear receptor-binding motifs and mediates transactivation through CBP binding-dependent and -independent pathways. EMBO J. 1998 Jan 15;17(2):507-19. [PubMed:9430642]
  5. Fryer CJ, Archer TK: Chromatin remodelling by the glucocorticoid receptor requires the BRG1 complex. Nature. 1998 May 7;393(6680):88-91. [PubMed:9590696]
  6. Atkins GB, Hu X, Guenther MG, Rachez C, Freedman LP, Lazar MA: Coactivators for the orphan nuclear receptor RORalpha. Mol Endocrinol. 1999 Sep;13(9):1550-7. [PubMed:10478845]
  7. Carrero P, Okamoto K, Coumailleau P, O'Brien S, Tanaka H, Poellinger L: Redox-regulated recruitment of the transcriptional coactivators CREB-binding protein and SRC-1 to hypoxia-inducible factor 1alpha. Mol Cell Biol. 2000 Jan;20(1):402-15. [PubMed:10594042]
  8. Watanabe M, Yanagisawa J, Kitagawa H, Takeyama K, Ogawa S, Arao Y, Suzawa M, Kobayashi Y, Yano T, Yoshikawa H, Masuhiro Y, Kato S: A subfamily of RNA-binding DEAD-box proteins acts as an estrogen receptor alpha coactivator through the N-terminal activation domain (AF-1) with an RNA coactivator, SRA. EMBO J. 2001 Mar 15;20(6):1341-52. [PubMed:11250900]
  9. Wu RC, Qin J, Hashimoto Y, Wong J, Xu J, Tsai SY, Tsai MJ, O'Malley BW: Regulation of SRC-3 (pCIP/ACTR/AIB-1/RAC-3/TRAM-1) Coactivator activity by I kappa B kinase. Mol Cell Biol. 2002 May;22(10):3549-61. [PubMed:11971985]
  10. Deguchi K, Ayton PM, Carapeti M, Kutok JL, Snyder CS, Williams IR, Cross NC, Glass CK, Cleary ML, Gilliland DG: MOZ-TIF2-induced acute myeloid leukemia requires the MOZ nucleosome binding motif and TIF2-mediated recruitment of CBP. Cancer Cell. 2003 Mar;3(3):259-71. [PubMed:12676584]
  11. Kindle KB, Troke PJ, Collins HM, Matsuda S, Bossi D, Bellodi C, Kalkhoven E, Salomoni P, Pelicci PG, Minucci S, Heery DM: MOZ-TIF2 inhibits transcription by nuclear receptors and p53 by impairment of CBP function. Mol Cell Biol. 2005 Feb;25(3):988-1002. [PubMed:15657427]
  12. Zhang H, Sun L, Liang J, Yu W, Zhang Y, Wang Y, Chen Y, Li R, Sun X, Shang Y: The catalytic subunit of the proteasome is engaged in the entire process of estrogen receptor-regulated transcription. EMBO J. 2006 Sep 20;25(18):4223-33. Epub 2006 Sep 7. [PubMed:16957778]
  13. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243]
  14. He Y, Simons SS Jr: STAMP, a novel predicted factor assisting TIF2 actions in glucocorticoid receptor-mediated induction and repression. Mol Cell Biol. 2007 Feb;27(4):1467-85. Epub 2006 Nov 20. [PubMed:17116691]
  15. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976]
  16. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  17. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330]
  18. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  19. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861]
  20. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  21. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  22. Druker J, Liberman AC, Antunica-Noguerol M, Gerez J, Paez-Pereda M, Rein T, Iniguez-Lluhi JA, Holsboer F, Arzt E: RSUME enhances glucocorticoid receptor SUMOylation and transcriptional activity. Mol Cell Biol. 2013 Jun;33(11):2116-27. doi: 10.1128/MCB.01470-12. Epub 2013 Mar 18. [PubMed:23508108]
  23. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  24. Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC: Uncovering global SUMOylation signaling networks in a site-specific manner. Nat Struct Mol Biol. 2014 Oct;21(10):927-36. doi: 10.1038/nsmb.2890. Epub 2014 Sep 14. [PubMed:25218447]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB0687117-METHYL-17-ALPHA-DIHYDROEQUILENINexperimentalunknownDetails
DB068984-(2-amino-1-methyl-1H-imidazo[4,5-b]pyridin-6-yl)phenolexperimentalunknownDetails
DB07080N-(2,2,2-TRIFLUOROETHYL)-N-{4-[2,2,2-TRIFLUORO-1-HYDROXY-1-(TRIFLUOROMETHYL)ETHYL]PHENYL}BENZENESULFONAMIDEexperimentalunknownDetails
DB070864-[(1S,2S,5S)-5-(HYDROXYMETHYL)-8-METHYL-3-OXABICYCLO[3.3.1]NON-7-EN-2-YL]PHENOLexperimentalunknownDetails
DB070874-[(1S,2S,5S,9R)-5-(HYDROXYMETHYL)-8,9-DIMETHYL-3-OXABICYCLO[3.3.1]NON-7-EN-2-YL]PHENOLexperimentalunknownDetails
DB071954-[(1S,2S,5S)-5-(HYDROXYMETHYL)-6,8,9-TRIMETHYL-3-OXABICYCLO[3.3.1]NON-7-EN-2-YL]PHENOLexperimentalunknownDetails
DB07678(9ALPHA,13BETA,17BETA)-2-[(1Z)-BUT-1-EN-1-YL]ESTRA-1,3,5(10)-TRIENE-3,17-DIOLexperimentalunknownDetails
DB07707(9BETA,11ALPHA,13ALPHA,14BETA,17ALPHA)-11-(METHOXYMETHYL)ESTRA-1(10),2,4-TRIENE-3,17-DIOLexperimentalunknownDetails
DB077083-CHLORO-2-(4-HYDROXYPHENYL)-2H-INDAZOL-5-OLexperimentalunknownDetails
DB077123-ETHYL-2-(4-HYDROXYPHENYL)-2H-INDAZOL-5-OLexperimentalunknownDetails
DB01645GenisteininvestigationalunknownDetails
DB078632-chloro-5-nitro-N-phenylbenzamideexperimentalunknownDetails
DB07932dimethyl (1R,4S)-5,6-bis(4-hydroxyphenyl)-7-oxabicyclo[2.2.1]hepta-2,5-diene-2,3-dicarboxylateexperimentalunknownDetails
DB080474-[1-allyl-7-(trifluoromethyl)-1H-indazol-3-yl]benzene-1,3-diolexperimentalunknownDetails
DB080484-(6-HYDROXY-1H-INDAZOL-3-YL)BENZENE-1,3-DIOLexperimentalunknownDetails
DB08175(2E,4E)-11-METHOXY-3,7,11-TRIMETHYLDODECA-2,4-DIENOIC ACIDexperimentalunknownDetails
DB08320DIETHYL (1R,2S,3R,4S)-5,6-BIS(4-HYDROXYPHENYL)-7-OXABICYCLO[2.2.1]HEPT-5-ENE-2,3-DICARBOXYLATEexperimentalunknownDetails
DB083982-Amino-1-methyl-6-phenylimidazo(4,5-b)pyridineinvestigationalunknownDetails
DB084022-[(2,4-DICHLOROBENZOYL)AMINO]-5-(PYRIMIDIN-2-YLOXY)BENZOIC ACIDexperimentalunknownDetails
DB02998MetriboloneexperimentalunknownDetails
DB085954-[(1S,2R,5S)-4,4,8-TRIMETHYL-3-OXABICYCLO[3.3.1]NON-7-EN-2-YL]PHENOLexperimentalunknownDetails
DB08601tributylstannanylexperimentalunknownDetails
DB08773RALOXIFENE COREexperimentalunknownDetails
DB00783Estradiolapproved, investigational, vet_approvedunknownDetails
DB00255Diethylstilbestrolapproved, investigationalunknownDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknownDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknownDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknownDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknownDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknownDetails