Solute carrier family 15 member 2

Details

Name
Solute carrier family 15 member 2
Synonyms
  • Kidney H(+)/peptide cotransporter
  • Oligopeptide transporter, kidney isoform
  • PEPT2
  • Peptide transporter 2
Gene Name
SLC15A2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037126|Solute carrier family 15 member 2
MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSY
YGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLV
YVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEER
TRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSK
IYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALT
RVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPLLVLIFIPLFD
FVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHS
VQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVG
EDYGVSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIED
IPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIV
LVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVKTEDMRGPADKHIPHIQGNMI
KLETKKTKL
Number of residues
729
Molecular Weight
81782.77
Theoretical pI
8.38
GO Classification
Functions
antibiotic transporter activity / dipeptide transporter activity / high-affinity oligopeptide transporter activity / peptide
Processes
drug transport / ion transport / protein transport / proton transport / transmembrane transport / transport
Components
extracellular exosome / integral component of plasma membrane / plasma membrane
General Function
Peptide:proton symporter activity
Specific Function
Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides.
Pfam Domain Function
Transmembrane Regions
58-78 88-108 115-135 140-160 184-204 218-238 296-316 344-364 381-401 568-588 612-632 644-664 675-695
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010792|Solute carrier family 15 member 2 (SLC15A2)
ATGAATCCTTTCCAGAAAAATGAGTCCAAGGAAACTCTTTTTTCACCTGTCTCCATTGAA
GAGGTACCACCTCGACCACCTAGCCCTCCAAAGAAGCCATCTCCGACAATCTGTGGCTCC
AACTATCCACTGAGCATTGCCTTCATTGTGGTGAATGAATTCTGCGAGCGCTTTTCCTAT
TATGGAATGAAAGCTGTGCTGATCCTGTATTTCCTGTATTTCCTGCACTGGAATGAAGAT
ACCTCCACATCTATATACCATGCCTTCAGCAGCCTCTGTTATTTTACTCCCATCCTGGGA
GCAGCCATTGCTGACTCGTGGTTGGGAAAATTCAAAGTCCTATCATTGATCGGCCTGAGT
CTAATAGCTTTGGGGACAGGAGGCATCAAACCCTGTGTGGCAGCTTTTGGTGGAGACCAG
TTTGAAGAAAAACATGCAGAGGAACGGACTAGATACTTCTCAGTCTTCTACCTGTCCATC
AATGCAGGGAGCTTGATTTCTACATTTATCACACCCATGCTGAGAGGAGATGTGCAATGT
TTTGGAGAAGACTGCTATGCATTGGCTTTTGGAGTTCCAGGACTGCTCATGGTAATTGCA
CTTGTTGTGTTTGCAATGGGAAGCAAAATATACAATAAACCACCCCCTGAAGGAAACATA
GTGGCTCAAGTTTTCAAATGTATCTGGTTTGCTATTTCCAATCGTTTCAAGAACCGTTCT
GGAGACATTCCAAAGCGACAGCACTGGCTAGACTGGGCGGCTGAGAAATATCCAAAGCAG
CTCATTATGGATGTAAAGGCACTGACCAGGGTACTATTCCTTTATATCCCATTGCCCATG
TTCTGGGCTCTTTTGGATCAGCAGGGTTCACGATGGACTTTGCAAGCCATCAGGATGAAT
AGGAATTTGGGGTTTTTTGTGCTTCAGCCGGACCAGATGCAGGTTCTAAATCCCCTTCTG
GTTCTTATCTTCATCCCGTTGTTTGACTTTGTCATTTATCGTCTGGTCTCCAAGTGTGGA
ATTAACTTCTCATCACTTAGGAAAATGGCTGTTGGTATGATCCTAGCATGCCTGGCATTT
GCAGTTGCGGCAGCTGTAGAGATAAAAATAAATGAAATGGCCCCAGCCCAGCCAGGTCCC
CAGGAGGTTTTCCTACAAGTCTTGAATCTGGCAGATGATGAGGTGAAGGTGACAGTGGTG
GGAAATGAAAACAATTCTCTGTTGATAGAGTCCATCAAATCCTTTCAGAAAACACCACAC
TATTCCAAACTGCACCTGAAAACAAAAAGCCAGGATTTTCACTTCCACCTGAAATATCAC
AATTTGTCTCTCTACACTGAGCATTCTGTGCAGGAGAAGAACTGGTACAGTCTTGTCATT
CGTGAAGATGGGAACAGTATCTCCAGCATGATGGTAAAGGATACAGAAAGCAGAACAACC
AATGGGATGACAACCGTGAGGTTTGTTAACACTTTGCATAAAGATGTCAACATCTCCCTG
AGTACAGATACCTCTCTCAATGTTGGTGAAGACTATGGTGTGTCTGCTTATAGAACTGTG
CAAAGAGGAGAATACCCTGCAGTGCACTGTAGAACAGAAGATAAGAACTTTTCTCTGAAT
TTGGGTCTTCTAGACTTTGGTGCAGCATATCTGTTTGTTATTACTAATAACACCAATCAG
GGTCTTCAGGCCTGGAAGATTGAAGACATTCCAGCCAACAAAATGTCCATTGCGTGGCAG
CTACCACAATATGCCCTGGTTACAGCTGGGGAGGTCATGTTCTCTGTCACAGGTCTTGAG
TTTTCTTATTCTCAGGCTCCCTCTAGCATGAAATCTGTGCTCCAGGCAGCTTGGCTATTG
ACAATTGCAGTTGGGAATATCATCGTGCTTGTTGTGGCACAGTTCAGTGGCCTGGTACAG
TGGGCCGAATTCATTTTGTTTTCCTGCCTCCTGCTGGTGATCTGCCTGATCTTCTCCATC
ATGGGCTACTACTATGTTCCTGTAAAGACAGAGGATATGCGGGGTCCAGCAGATAAGCAC
ATTCCTCACATCCAGGGGAACATGATCAAACTAGAGACCAAGAAGACAAAACTCTGA
Chromosome Location
3
Locus
3q13.33
External Identifiers
ResourceLink
UniProtKB IDQ16348
UniProtKB Entry NameS15A2_HUMAN
GenBank Protein ID999213
GenBank Gene IDS78203
GenAtlas IDSLC15A2
HGNC IDHGNC:10921
General References
  1. Liu W, Liang R, Ramamoorthy S, Fei YJ, Ganapathy ME, Hediger MA, Ganapathy V, Leibach FH: Molecular cloning of PEPT 2, a new member of the H+/peptide cotransporter family, from human kidney. Biochim Biophys Acta. 1995 May 4;1235(2):461-6. [PubMed:7756356]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01000CyclacillinapprovedunknowninhibitorDetails
DB01140Cefadroxilapproved, vet_approved, withdrawnunknowninhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedunknowninhibitorDetails
DB01415Ceftibutenapproved, investigationalunknowninhibitorDetails
DB00671Cefiximeapproved, investigationalunknowninhibitorDetails
DB00535CefdinirapprovedunknowninhibitorDetails
DB03424Ubenimexexperimental, investigationalunknownsubstrateinhibitorDetails
DB00855Aminolevulinic acidapprovedunknowninhibitorDetails
DB00447Loracarbefapproved, investigational, withdrawnunknowninhibitorDetails
DB01333CefradineapprovedunknowninhibitorDetails
DB00415Ampicillinapproved, vet_approvedunknowninhibitorDetails
DB01060Amoxicillinapproved, vet_approvedunknowninhibitorDetails
DB00577Valaciclovirapproved, investigationalunknownsubstrateinhibitorDetails
DB01016GlyburideapprovedunknowninhibitorDetails
DB00438CeftazidimeapprovedunknowninhibitorDetails
DB01413Cefepimeapproved, investigationalunknowninhibitorDetails
DB01124Tolbutamideapproved, investigationalunknowninhibitorDetails
DB00731Nateglinideapproved, investigationalunknowninhibitorDetails
DB00672Chlorpropamideapproved, investigationalunknowninhibitorDetails
DB01212CeftriaxoneapprovedunknowninhibitorDetails
DB00493CefotaximeapprovedunknowninhibitorDetails
DB01112CefuroximeapprovedunknowninhibitorDetails
DB01053Benzylpenicillinapproved, vet_approvedunknowninhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00274Cefmetazoleapproved, investigationalunknowninhibitorDetails
DB00713Oxacillinapproved, investigationalunknowninhibitorDetails
DB01147Cloxacillinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00485Dicloxacillinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00833CefaclorapprovedunknowninhibitorDetails
DB00881Quinaprilapproved, investigationalunknownsubstrateDetails
DB00542Benazeprilapproved, investigationalunknownsubstrateDetails
DB01340CilazaprilapprovedunknownsubstrateDetails
DB00492FosinoprilapprovedunknownsubstrateDetails
DB00691MoexiprilapprovedunknownsubstrateDetails
DB00790PerindoprilapprovedunknownsubstrateDetails
DB00178RamiprilapprovedunknownsubstrateDetails
DB01348SpiraprilapprovedunknownsubstrateDetails
DB00519TrandolaprilapprovedunknownsubstrateDetails
DB08795AzidocillinexperimentalunknowninhibitorDetails
DB00302Tranexamic acidapprovedunknownDetails
DB01610Valganciclovirapproved, investigationalunknownDetails
DB00415Ampicillinapproved, vet_approvedunknownDetails
DB00493CefotaximeapprovedunknownDetails
DB00713Oxacillinapproved, investigationalunknownDetails
DB01053Benzylpenicillinapproved, vet_approvedunknownDetails
DB00781Polymyxin Bapproved, vet_approvedunknownDetails