Diacylglycerol kinase delta

Details

Name
Diacylglycerol kinase delta
Synonyms
  • 130 kDa diacylglycerol kinase
  • 2.7.1.107
  • DAG kinase delta
  • DGK-delta
  • Diglyceride kinase delta
  • KIAA0145
Gene Name
DGKD
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004510|Diacylglycerol kinase delta
MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTIIKEGML
TKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
CRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDADGIAMPHQWLE
GNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLTKCPLGLCKVSVIPPTA
LNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTVTEDFSEDSEVQQILFY
EDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKCS
VLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSICGSTGDRLVASACPARP
QIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGFVLGLSESEEKMDHRVC
PPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPPQPGSRDGLPALNTKIL
YPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVMNNYFGIGLDAKISLDF
NNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSLQGIAV
LNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIRLQHHRIAQCR
TVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRAFESTLKSWEDKQKCEL
PRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSM
DRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMD
RQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHSSLGA
PVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRILC
GIKELSRSAPAVEA
Number of residues
1214
Molecular Weight
134524.235
Theoretical pI
7.58
GO Classification
Functions
ATP binding / diacylglycerol binding / diacylglycerol kinase activity / metal ion binding / protein heterodimerization activity / protein homodimerization activity
Processes
blood coagulation / cell growth / diacylglycerol metabolic process / endocytosis / epidermal growth factor receptor signaling pathway / multicellular organismal development / platelet activation / protein homooligomerization / protein kinase C-activating G-protein coupled receptor signaling pathway / protein transport / response to organic substance / second-messenger-mediated signaling / signal transduction
Components
cytoplasm / cytoplasmic membrane-bounded vesicle / plasma membrane
General Function
Protein homodimerization activity
Specific Function
May function as signaling molecule.Isoform 2 may be involved in cell growth and tumorigenesis. Involved in clathrin-dependent endocytosis.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0011654|Diacylglycerol kinase delta (DGKD)
ATGAATATGTTTCTGTACTTTCAGACCATCATCAAAGAGGGGATGCTGACCAAACAGAAC
AATTCATTCCAGCGATCAAAAAGGAGATACTTTAAGCTTCGAGGGCGAACGCTTTACTAT
GCCAAAACGGCAAAGTCAATCATATTTGATGAGGTGGATCTGACAGATGCCAGCGTAGCT
GAATCCAGTACCAAAAACGTCAACAACAGTTTTACGGTCATAACTCCATGCAGGAAGCTC
ATCTTGTGTGCTGATAACAGAAAAGAAATGGAAGATTGGATTGCAGCATTAAAGACTGTG
CAGAACAGGGAGCACTTTGAGCCCACCCAGTACAGCATGGACCACTTCTCAGGGATGCAC
AATTGGTACGCCTGTTCCCACGCGAGGCCGACCTACTGCAATGTGTGCCGTGAGGCTCTG
TCTGGGGTCACGTCGCACGGGCTGTCCTGCGAGGTGTGCAAATTTAAGGCCCACAAGCGC
TGTGCTGTGCGTGCAACCAATAACTGCAAGTGGACCACACTGGCCTCGATCGGGAAGGAC
ATCATTGAAGATGCAGATGGGATTGCAATGCCCCACCAGTGGTTGGAAGGAAACCTACCT
GTGAGCGCCAAGTGCACTGTGTGCGACAAGACCTGTGGCAGTGTGCTGCGCCTGCAGGAC
TGGCGCTGCCTCTGGTGCAAGGCCATGGTTCACACATCGTGTAAAGAATCCTTGCTGACC
AAGTGCCCACTTGGCCTGTGCAAAGTGTCAGTCATCCCACCCACGGCTCTCAACAGCATC
GACTCCGATGGGTTCTGGAAGGCCAGCTGTCCTCCTTCTTGCACAAGCCCACTGTTGGTC
TTCGTCAATTCAAAAAGTGGGGACAACCAGGGTGTGAAGTTCCTCAGAAGATTCAAACAG
CTACTAAACCCCGCCCAGGTCTTCGACCTCATGAACGGAGGCCCACACCTCGGCTTACGG
TTATTCCAGAAGTTTGACACATTCCGGATTCTGGTTTGTGGCGGGGATGGAAGTGTTGGC
TGGGTCCTCTCCGAAATCGACAGCCTCAACCTTCATAAACAGTGTCAGCTGGGAGTGCTG
CCGCTCGGCACAGGGAACGACTTGGCCCGAGTACTGGGCTGGGGCTCAGCCTGCGATGAC
GACACCCAGCTCCCCCAGATCTTGGAGAAGTTGGAGAGAGCCAGCACCAAGATGCTGGAC
AGGTGGAGCGTCATGGCATACGAGGCCAAGCTCCCCCGGCAGGCCTCCTCCTCTACCGTC
ACCGAAGACTTCAGCGAGGATTCCGAGGTACAGCAGATTCTCTTCTATGAAGACTCGGTT
GCAGCCCACCTTTCTAAAATCCTCACCTCGGACCAGCACTCGGTGGTCATCTCCTCGGCC
AAAGTGCTCTGTGAGACGGTGAAGGACTTCGTGGCACGGGTGGGGAAGGCCTATGAGAAG
ACGACCGAGAGCTCGGAGGAGTCAGAGGTCATGGCCAAGAAGTGCTCTGTCCTGAAAGAG
AAGCTGGATTCCCTTCTCAAGACCTTGGACGATGAGTCCCAGGCCTCGTCCTCTCTGCCC
AACCCGCCCCCCACCATTGCCGAGGAGGCTGAAGATGGAGATGGGTCGGGCAGCATCTGC
GGTTCCACCGGAGACCGCTTGGTGGCATCAGCTTGCCCGGCCCGGCCGCAGATATTCCGG
CCTCGAGAACAGCTCATGCTGAGAGCCAACAGCCTGAAGAAAGCAATTCGTCAGATCATA
GAACACACAGAAAAAGCTGTCGATGAGCAGAATGCCCAGACCCAGGAGCAGGAGGGCTTC
GTCCTGGGCCTCTCTGAGTCAGAGGAGAAGATGGACCACAGAGTGTGCCCACCACTGTCC
CACAGCGAGAGCTTCGGGGTCCCCAAGGGGAGGAGCCAGCGCAAAGTGTCGAAATCTCCG
TGTGAAAAGCTGATCAGCAAAGGGAGTCTGTCCCTAGGCAGTTCTGCTTCCCTTCCGCCC
CAGCCGGGAAGCCGGGACGGCCTGCCTGCGCTCAACACCAAGATCCTGTACCCAAATGTC
CGGGCTGGAATGTCTGGTTCCTTACCCGGTGGCTCAGTCATCAGTCGCCTGTTAATTAAT
GCTGATCCCTTCAACTCTGAACCAGAAACCCTAGAGTATTACACGGAGAAATGTGTCATG
AACAACTATTTTGGCATTGGCCTGGATGCGAAGATATCCCTGGACTTTAACAACAAGCGC
GATGAGCACCCAGAGAAGTGCAGGAGCCGAACCAAGAACATGATGTGGTATGGAGTTCTT
GGAACCAAAGAGTTGCTGCACAGAACCTACAAGAACCTGGAGCAAAAGGTCTTGCTGGAG
TGTGACGGGCGACCCATCCCACTCCCCAGTCTTCAGGGAATTGCTGTCCTTAACATTCCC
AGCTATGCCGGAGGAACCAACTTCTGGGGGGGTACCAAGGAAGATGATACTTTCGCAGCT
CCATCATTCGATGACAAGATTCTGGAGGTGGTCGCCGTGTTCGGCAGCATGCAGATGGCC
GTCTCTCGAGTCATCAGGCTACAGCATCATCGGATCGCCCAGTGTCGCACGGTGAAGATC
TCCATCCTTGGGGATGAGGGCGTGCCTGTGCAGGTGGACGGAGAGGCCTGGGTCCAGCCG
CCAGGGTACATTCGGATTGTCCACAAGAACCGGGCACAGACACTGACCAGAGACAGGGCA
TTTGAGAGCACCCTGAAGTCCTGGGAAGACAAGCAGAAGTGCGAGCTGCCCCGCCCTCCA
TCCTGTTCCCTGCACCCGGAGATGCTGTCCGAGGAGGAGGCCACCCAGATGGACCAGTTT
GGGCAGGCAGCAGGGGTCCTCATTCACAGTATCCGAGAAATAGCTCAGTCTCACCGGGAC
ATGGAGCAGGAACTGGCCCACGCCGTCAATGCCAGCTCCAAGTCCATGGACCGTGTGTAT
GGCAAGCCCAGAACCACAGAGGGGCTCAACTGCAGCTTCGTCCTGGAAATGGTGAATAAC
TTCAGAGCTCTGCGCAGTGAGACGGAGCTGCTGCTGTCTGGGAAGATGGCCCTGCAGCTG
GATCCGCCTCAGAAGGAGCAGCTGGGGAGTGCTCTTGCCGAGATGGACCGACAGCTCAGG
AGGCTGGCAGACACCCCGTGGCTCTGCCAGTCCGCAGAGCCCGGCGACGAAGAGAGTGTG
ATGCTGGATCTTGCCAAGCGCAGTCGCAGTGGTAAATTCCGCCTCGTGACCAAGTTTAAA
AAGGAGAAAAACAACAAGAACAAAGAAGCTCACAGTAGCCTGGGAGCCCCGGTTCACCTC
TGGGGGACAGAGGAGGTTGCTGCCTGGCTGGAGCACCTCAGTCTCTGTGAGTATAAGGAC
ATCTTCACACGGCACGACATCCGGGGCTCTGAGCTCCTGCACCTGGAGCGGAGGGACCTC
AAGGACCTGGGCGTGACCAAGGTGGGCCACATGAAGAGGATCCTGTGTGGCATCAAGGAG
CTGAGCCGCAGCGCCCCCGCCGTCGAGGCCTAG
Chromosome Location
2
Locus
2q37.1
External Identifiers
ResourceLink
UniProtKB IDQ16760
UniProtKB Entry NameDGKD_HUMAN
GenBank Protein ID22773821
GenBank Gene IDAB078966
GenAtlas IDDGKD
HGNC IDHGNC:2851
General References
  1. Sakane F, Imai S, Yamada K, Murakami T, Tsushima S, Kanoh H: Alternative splicing of the human diacylglycerol kinase delta gene generates two isoforms differing in their expression patterns and in regulatory functions. J Biol Chem. 2002 Nov 8;277(45):43519-26. Epub 2002 Aug 27. [PubMed:12200442]
  2. Nagase T, Seki N, Tanaka A, Ishikawa K, Nomura N: Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1995 Aug 31;2(4):167-74, 199-210. [PubMed:8590280]
  3. Sakane F, Imai S, Kai M, Wada I, Kanoh H: Molecular cloning of a novel diacylglycerol kinase isozyme with a pleckstrin homology domain and a C-terminal tail similar to those of the EPH family of protein-tyrosine kinases. J Biol Chem. 1996 Apr 5;271(14):8394-401. [PubMed:8626538]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Imai S, Sakane F, Kanoh H: Phorbol ester-regulated oligomerization of diacylglycerol kinase delta linked to its phosphorylation and translocation. J Biol Chem. 2002 Sep 20;277(38):35323-32. Epub 2002 Jun 25. [PubMed:12084710]
  6. Kawasaki T, Kobayashi T, Ueyama T, Shirai Y, Saito N: Regulation of clathrin-dependent endocytosis by diacylglycerol kinase delta: importance of kinase activity and binding to AP2alpha. Biochem J. 2008 Jan 15;409(2):471-9. [PubMed:17880279]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00144Phosphatidyl serineapproved, investigational, nutraceuticalunknownDetails
DB14001alpha-Tocopherol succinateapproved, nutraceutical, vet_approvedunknownDetails