RNA polymerase sigma factor SigA

Details

Name
RNA polymerase sigma factor SigA
Synonyms
  • sigA
Gene Name
sigA1
Organism
Peptoclostridium difficile (strain 630)
Amino acid sequence
>lcl|BSEQ0019629|RNA polymerase sigma factor SigA
MSVENKSNKKELKKVTAKTLIEKGKKQGSLTLAEIMEAFSETELDKDQVENLYETLGNLG
IEITETKNYKADIDFSVADDDLSIGHLDEDAEAISHDDSSAIEIETVDLSLPKGISIDDP
VRMYLKEIGKIPLLKPHEEVEFARRMHEGDEIAKQRLVEANLRLVVSIAKRYVGRGMLFL
DLIQEGNLGLIKAVEKFDYTKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINK
LIRVSRQLLQELGRDPKPEEIAKEMEMTEDKVREIMKIAQDPVSLETPIGEEEDSHLGDF
IPDDDAPAPAEAAAYSLLKEQIEDVLGSLNDREQKVLKLRFGLEDGRARTLEEVGKEFDV
TRERIRQIEAKALRKLRHPSRSKKLRDYLD
Number of residues
390
Molecular Weight
44426.185
Theoretical pI
Not Available
GO Classification
Functions
DNA binding / sigma factor activity / transcription factor activity, sequence-specific DNA binding
Processes
transcription initiation from bacterial-type RNA polymerase promoter
Components
cytoplasm
General Function
Transcription factor activity, sequence-specific dna binding
Specific Function
Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is the primary sigma factor during exponential growth.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0019630|RNA polymerase sigma factor SigA (sigA1)
TTGAGTGTGGAAAATAAATCGAATAAAAAAGAGTTAAAAAAGGTTACTGCTAAGACATTA
ATAGAAAAAGGAAAAAAGCAAGGTTCTCTGACACTTGCAGAGATAATGGAAGCTTTTTCG
GAGACTGAACTTGATAAGGATCAAGTAGAAAATCTTTATGAGACTTTAGGAAATTTGGGA
ATAGAAATAACAGAAACAAAAAACTATAAAGCTGATATAGATTTTTCGGTTGCTGATGAC
GATTTAAGTATAGGCCACTTAGATGAAGATGCAGAGGCAATTTCACATGATGACTCTTCT
GCAATAGAAATAGAAACTGTGGATTTATCTTTACCAAAAGGGATAAGTATAGATGACCCT
GTAAGAATGTACTTAAAAGAAATAGGAAAAATTCCTCTACTTAAACCACATGAAGAAGTA
GAATTTGCTAGAAGGATGCACGAAGGTGATGAGATAGCAAAACAAAGGTTAGTTGAAGCA
AACTTAAGACTAGTTGTAAGTATAGCAAAAAGATATGTAGGAAGAGGTATGCTTTTCTTG
GATTTAATACAAGAGGGAAATTTAGGTCTTATAAAAGCAGTCGAAAAATTTGACTATACA
AAAGGATATAAGTTTAGTACTTATGCAACATGGTGGATAAGACAAGCTATAACACGTGCT
ATTGCAGACCAAGCTAGAACTATAAGAATACCAGTTCATATGGTAGAGACTATAAATAAG
CTAATAAGAGTATCAAGACAACTACTTCAAGAACTTGGAAGAGATCCAAAACCAGAAGAA
ATTGCAAAAGAAATGGAAATGACAGAAGATAAAGTAAGAGAAATAATGAAAATAGCTCAA
GACCCTGTGTCTTTAGAAACACCAATAGGAGAAGAAGAAGATAGCCATTTAGGTGACTTT
ATTCCAGATGATGATGCTCCAGCCCCAGCAGAGGCAGCAGCATATTCTTTATTAAAAGAA
CAAATAGAAGATGTACTTGGTTCATTAAATGATAGAGAACAAAAAGTATTAAAGCTTAGA
TTTGGTCTTGAGGATGGTAGAGCCAGAACTCTTGAGGAAGTTGGAAAAGAGTTTGATGTA
ACTAGAGAGAGAATAAGACAGATAGAAGCAAAAGCACTAAGAAAACTAAGACATCCAAGT
AGATCAAAAAAACTTAGAGATTATTTAGACTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ18BX5
UniProtKB Entry NameQ18BX5_PEPD6
General References
  1. Sebaihia M, Wren BW, Mullany P, Fairweather NF, Minton N, Stabler R, Thomson NR, Roberts AP, Cerdeno-Tarraga AM, Wang H, Holden MT, Wright A, Churcher C, Quail MA, Baker S, Bason N, Brooks K, Chillingworth T, Cronin A, Davis P, Dowd L, Fraser A, Feltwell T, Hance Z, Holroyd S, Jagels K, Moule S, Mungall K, Price C, Rabbinowitsch E, Sharp S, Simmonds M, Stevens K, Unwin L, Whithead S, Dupuy B, Dougan G, Barrell B, Parkhill J: The multidrug-resistant human pathogen Clostridium difficile has a highly mobile, mosaic genome. Nat Genet. 2006 Jul;38(7):779-86. Epub 2006 Jun 25. [PubMed:16804543]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08874FidaxomicinapprovedyesinhibitorDetails