GTPase (Rab6)

Details

Name
GTPase (Rab6)
Synonyms
  • Rab6
Gene Name
rab6
Organism
Plasmodium falciparum
Amino acid sequence
>lcl|BSEQ0012289|GTPase (Rab6)
MDEFQNSGLNKYKLVFLGEQAVGKTSIITRFMYDTFDNNYQSTIGIDFLSKTLYLDEGPV
RLQLWDTAGQERFRSLIPSYIRDSAAAIVVYDITNRQSFENTTKWIQDILNERGKDVIIA
LVGNKTDLGDLRKVTYEEGMQKAQEYNTMFHETSAKAGHNIKVLFKKTASKLPNLDNTNN
NEANVVDIQLTNNSNKNDKNMLSKCLC
Number of residues
207
Molecular Weight
23597.46
Theoretical pI
6.54
GO Classification
Functions
GTP binding
Processes
protein transport / small GTPase mediated signal transduction
Components
intracellular
General Function
Gtp binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0006396|624 bp
ATGGATGAATTTCAAAACTCGGGACTAAATAAATACAAACTTGTTTTCTTAGGAGAACAA
GCTGTTGGTAAAACATCTATAATTACAAGATTCATGTATGATACCTTTGATAATAATTAC
CAATCGACTATTGGTATAGATTTTTTGAGTAAGACATTATATTTGGATGAAGGTCCTGTA
CGCTTACAATTGTGGGACACTGCAGGTCAGGAAAGATTTCGAAGTTTAATTCCAAGTTAT
ATTAGGGACTCCGCAGCAGCAATTGTTGTATATGATATTACTAATAGACAATCCTTTGAA
AATACCACAAAATGGATACAGGATATTTTGAATGAGAGAGGAAAAGATGTTATAATTGCT
TTAGTAGGAAATAAAACAGATTTAGGTGATCTTAGAAAAGTTACATATGAAGAAGGAATG
CAAAAAGCTCAAGAATATAATACCATGTTTCATGAAACGAGTGCTAAAGCTGGACATAAT
ATAAAAGTTTTGTTTAAAAAAACTGCATCAAAATTACCAAATTTAGATAATACAAATAAT
AATGAAGCCAATGTTGTAGATATACAATTAACTAATAATTCAAATAAAAATGACAAAAAT
ATGTTAAGTAAATGTTTATGTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ26000
UniProtKB Entry NameQ26000_PLAFA
GenBank Gene IDX92977
General References
  1. de Castro FA, Ward GE, Jambou R, Attal G, Mayau V, Jaureguiberry G, Braun-Breton C, Chakrabarti D, Langsley G: Identification of a family of Rab G-proteins in Plasmodium falciparum and a detailed characterisation of pfrab6. Mol Biochem Parasitol. 1996 Sep;80(1):77-88. [PubMed:8885224]
  2. Chattopadhyay D, Langsley G, Carson M, Recacha R, DeLucas L, Smith C: Structure of the nucleotide-binding domain of Plasmodium falciparum rab6 in the GDP-bound form. Acta Crystallogr D Biol Crystallogr. 2000 Aug;56(Pt 8):937-44. [PubMed:10944329]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04315Guanosine-5'-DiphosphateexperimentalunknownDetails