L-lactate dehydrogenase

Details

Name
L-lactate dehydrogenase
Synonyms
  • 1.1.1.27
  • LDH-P
Gene Name
Not Available
Organism
Plasmodium falciparum (isolate CDC / Honduras)
Amino acid sequence
>lcl|BSEQ0011017|L-lactate dehydrogenase
MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCK
VSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNA
FIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVG
AHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPA
AAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKA
KFDEAIAETKRMKALA
Number of residues
316
Molecular Weight
34107.505
Theoretical pI
7.63
GO Classification
Functions
L-lactate dehydrogenase activity
Processes
carbohydrate metabolic process / carboxylic acid metabolic process
General Function
L-lactate dehydrogenase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0002873|951 bp
ATGGCACCAAAAGCAAAAATCGTTTTAGTTGGCTCAGGTATGATTGGAGGAGTAATGGCT
ACCTTAATTGTTCAGAAAAATTTAGGAGATGTAGTTTTGTTCGATATTGTAAAGAACATG
CCACATGGAAAAGCTTTAGATACATCTCATACTAATGTTATGGCATATTCAAATTGCAAA
GTAAGTGGTTCAAACACTTATGACGATTTGGCTGGAGCAGATGTAGTAATAGTAACAGCT
GGATTTACCAAGGCCCCAGGAAAGAGTGACAAAGAATGGAATAGAGATGATTTATTACCA
TTAAACAACAAGATTATGATTGAAATTGGTGGTCATATTAAGAAGAATTGTCCAAATGCT
TTTATTATTGTTGTAACAAACCCAGTAGATGTTATGGTACAATTATTACATCAACATTCA
GGTGTTCCTAAAAACAAGATTATTGGTTTAGGTGGTGTATTAGATACATCAAGATTGAAG
TATTACATATCTCAGAAATTAAATGTATGCCCAAGAGATGTAAATGCACACATTGTAGGT
GCTCATGGAAATAAAATGGTTCTTTTAAAAAGATACATTACTGTAGGTGGTATCCCTTTA
CAAGAATTTATTAATAACAAGTTAATTTCTGATGCTGAATTAGAAGCTATATTTGATAGA
ACTGTTAATACTGCATTAGAAATTGTAAACTTACATGCATCACCATATGTTGCACCAGCT
GCTGCTATTATCGAAATGGCTGAATCCTACTTAAAAGATTTGAAAAAAGTATTAATTTGC
TCAACCTTGTTAGAAGGACAATATGGACACTCCGATATATTCGGTGGTACACCTGTTGTT
TTAGGTGCTAATGGTGTTGAACAAGTTATCGAATTACAATTAAATAGTGAGGAAAAAGCT
AAATTTGATGAAGCCATAGCTGAAACTAAGAGAATGAAGGCATTAGCTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ27743
UniProtKB Entry NameLDH_PLAFD
GenBank Protein ID294165
GenBank Gene IDM93720
General References
  1. Bzik DJ, Fox BA, Gonyer K: Expression of Plasmodium falciparum lactate dehydrogenase in Escherichia coli. Mol Biochem Parasitol. 1993 May;59(1):155-66. [PubMed:8515777]
  2. Dunn CR, Banfield MJ, Barker JJ, Higham CW, Moreton KM, Turgut-Balik D, Brady RL, Holbrook JJ: The structure of lactate dehydrogenase from Plasmodium falciparum reveals a new target for anti-malarial design. Nat Struct Biol. 1996 Nov;3(11):912-5. [PubMed:8901865]
  3. Read JA, Wilkinson KW, Tranter R, Sessions RB, Brady RL: Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase. J Biol Chem. 1999 Apr 9;274(15):10213-8. [PubMed:10187806]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB021113-hydroxyisoxazole-4-carboxylic acidexperimentalunknownDetails
DB024014-Hydroxy-1,2,5-oxadiazole-3-carboxylic acidexperimentalunknownDetails
DB031624-oxo-4,5-dihydro-1,2,5-thiadiazole-3-carboxylic acidexperimentalunknownDetails
DB03940Oxamic AcidexperimentalunknownDetails
DB04640Naphthalene-2,6-disulfonic acidexperimentalunknownDetails
DB046413,7-DIHYDROXYNAPHTHALENE-2-CARBOXYLIC ACIDexperimentalunknownDetails
DB11638Artenimolexperimental, investigationalunknownligandDetails