Hypoxanthine-guanine phosphoribosyltransferase

Details

Name
Hypoxanthine-guanine phosphoribosyltransferase
Synonyms
  • EC 2.4.2.8
Gene Name
HGPRTase
Organism
Trypanosoma cruzi
Amino acid sequence
>lcl|BSEQ0022284|Hypoxanthine-guanine phosphoribosyltransferase
MPREYEFAEKILFTEEEIRTRIMEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTAD
LCRALSDFNVPVRMEFICVSSYGEGVTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTL
NYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELR
DIVVLRPEVYAEREAARQKKQRAIGSADTDRDAKREFHSKY
Number of residues
221
Molecular Weight
25529.02
Theoretical pI
7.61
GO Classification
Functions
guanine phosphoribosyltransferase activity / hypoxanthine phosphoribosyltransferase activity
Processes
purine ribonucleoside salvage
Components
cytoplasm
General Function
Hypoxanthine phosphoribosyltransferase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm (By similarity)
Gene sequence
>lcl|BSEQ0004885|666 bp
ATGCCACGGGAGTACGAGTTTGCAGAGAAGATTCTTTTCACAGAAGAGGAGATCCGCACC
CGCATTATGGAGGTTGCCAAGCGCATTGCGGATGACTACAAGGGAAAGGGTCTGCGCCCT
TATGTCAACCCTCTTGTGCTCATATCTGTGCTGAAGGGAAGCTTTATGTTTACTGCTGAC
TTGTGCCGTGCACTGAGTGATTTCAACGTGCCGGTGCGAATGGAGTTCATTTGCGTCTCA
TCATATGGCGAAGGAGTCACGAGCTCCGGTCAGGTGCGCATGTTGCTTGACACGCGTCAC
AGCATTGAGGGGCACCATGTGTTGATTGTGGAGGACATTGTTGACACCGCCCTTACGCTG
AATTACTTGTACCACATGTATTTTACACGCAGGCCAGCGAGCTTAAAAACAGTTGTGTTG
CTTGACAAGCGTGAGGGGCGACGCGTGCCCTTTTCTGCGGACTACGTTGTGGCGAATATA
CCCAACGCCTTTGTGATTGGCTACGGTCTTGATTACGACGACACCTACCGTGAGTTACGC
GATATTGTTGTTCTTCGTCCGGAGGTGTATGCGGAGAGGGAGGCGGCGCGGCAGAAGAAG
CAGCGGGCCATTGGTAGCGCTGACACCGACAGAGACGCCAAGAGGGAGTTTCATAGCAAG
TACTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ27796
UniProtKB Entry NameQ27796_TRYCR
GenBank Gene IDL07486
General References
  1. Allen TE, Ullman B: Molecular characterization and overexpression of the hypoxanthine-guanine phosphoribosyltransferase gene from Trypanosoma cruzi. Mol Biochem Parasitol. 1994 Jun;65(2):233-45. [PubMed:7969265]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB016325-O-phosphono-alpha-D-ribofuranosyl diphosphateapproved, experimental, investigationalunknownDetails
DB01942Formic acidexperimental, investigationalunknownDetails
DB04198Formycin BexperimentalunknownDetails
DB04566Inosinic AcidexperimentalunknownDetails