ATP-binding cassette sub-family B member 5

Details

Name
ATP-binding cassette sub-family B member 5
Synonyms
  • ABCB5 P-gp
  • P-glycoprotein ABCB5
Gene Name
ABCB5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037199|ATP-binding cassette sub-family B member 5
MENSERAEEMQENYQRNGTAEEQPKLRKEAVGSIEIFRFADGLDITLMILGILASLVNGA
CLPLMPLVLGEMSDNLISGCLVQTNTTNYQNCTQSQEKLNEDMTLLTLYYVGIGVAALIF
GYIQISLWIITAARQTKRIRKQFFHSVLAQDIGWFDSCDIGELNTRMTDDIDKISDGIGD
KIALLFQNMSTFSIGLAVGLVKGWKLTLVTLSTSPLIMASAAACSRMVISLTSKELSAYS
KAGAVAEEVLSSIRTVIAFRAQEKELQRYTQNLKDAKDFGIKRTIASKVSLGAVYFFMNG
TYGLAFWYGTSLILNGEPGYTIGTVLAVFFSVIHSSYCIGAAVPHFETFAIARGAAFHIF
QVIDKKPSIDNFSTAGYKPESIEGTVEFKNVSFNYPSRPSIKILKGLNLRIKSGETVALV
GLNGSGKSTVVQLLQRLYDPDDGFIMVDENDIRALNVRHYRDHIGVVSQEPVLFGTTISN
NIKYGRDDVTDEEMERAAREANAYDFIMEFPNKFNTLVGEKGAQMSGGQKQRIAIARALV
RNPKILILDEATSALDSESKSAVQAALEKASKGRTTIVVAHRLSTIRSADLIVTLKDGML
AEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFID
KAEESTQSKEISLPEVSLLKILKLNKPEWPFVVLGTLASVLNGTVHPVFSIIFAKIITMF
GNNDKTTLKHDAEIYSMIFVILGVICFVSYFMQGLFYGRAGEILTMRLRHLAFKAMLYQD
IAWFDEKENSTGGLTTILAIDIAQIQGATGSRIGVLTQNATNMGLSVIISFIYGWEMTFL
ILSIAPVLAVTGMIETAAMTGFANKDKQELKHAGKIATEALENIRTIVSLTREKAFEQMY
EEMLQTQHRNTSKKAQIIGSCYAFSHAFIYFAYAAGFRFGAYLIQAGRMTPEGMFIVFTA
IAYGAMAIGETLVLAPEYSKAKSGAAHLFALLEKKPNIDSRSQEGKKPDTCEGNLEFREV
SFFYPCRPDVFILRGLSLSIERGKTVAFVGSSGCGKSTSVQLLQRLYDPVQGQVLFDGVD
AKELNVQWLRSQIAIVPQEPVLFNCSIAENIAYGDNSRVVPLDEIKEAANAANIHSFIEG
LPEKYNTQVGLKGAQLSGGQKQRLAIARALLQKPKILLLDEATSALDNDSEKVVQHALDK
ARTGRTCLVVTHRLSAIQNADLIVVLHNGKIKEQGTHQELLRNRDIYFKLVNAQSVQ
Number of residues
1257
Molecular Weight
138639.48
Theoretical pI
8.41
GO Classification
Functions
ATP binding / ATPase activity, coupled to transmembrane movement of substances / efflux transmembrane transporter activity
Processes
antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent / antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent / antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent / cell differentiation / compound eye corneal lens development / positive regulation of antigen processing and presentation of peptide antigen via MHC class I / regulation of membrane potential / transmembrane transport
Components
integral component of plasma membrane / plasma membrane
General Function
Efflux transmembrane transporter activity
Specific Function
Drug efflux transporter present in a number of stem cells that acts as a regulator of cellular differentiation. Able to mediate efflux from cells of the rhodamine dye and of the therapeutic drug doxorubicin. Specifically present in limbal stem cells, where it plays a key role in corneal development and repair.
Pfam Domain Function
Transmembrane Regions
49-69 110-130 181-201 203-223 294-314 322-342 693-713 737-757 827-847 917-937 954-974
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0011699|ATP-binding cassette sub-family B member 5 (ABCB5)
ATGGAAAATTCAGAAAGAGCTGAAGAAATGCAAGAAAATTATCAGAGAAATGGAACTGCA
GAAGAACAGCCAAAACTGAGAAAGGAAGCAGTTGGATCTATTGAGATATTCCGCTTTGCT
GATGGACTGGACATCACACTCATGATCCTGGGTATACTGGCATCACTGGTCAATGGAGCC
TGCCTTCCTTTAATGCCACTGGTTTTAGGAGAAATGAGTGATAACCTTATTAGTGGATGT
CTAGTCCAAACTAACACAACAAATTATCAGAACTGTACTCAGTCTCAAGAGAAGCTGAAT
GAAGATATGACTCTGTTGACCCTGTATTATGTTGGAATAGGTGTTGCTGCCTTGATTTTT
GGTTACATACAGATTTCCTTGTGGATTATAACTGCAGCACGACAGACCAAGAGGATTCGA
AAACAGTTTTTTCATTCAGTTTTGGCACAGGACATCGGCTGGTTTGATAGCTGTGACATC
GGTGAACTTAACACTCGCATGACAGATGACATTGACAAAATCAGTGATGGTATTGGAGAT
AAGATTGCTCTGTTGTTTCAAAACATGTCTACTTTTTCGATTGGCCTGGCAGTTGGTTTG
GTGAAGGGCTGGAAACTCACCCTAGTGACTCTATCCACGTCTCCTCTTATAATGGCTTCA
GCGGCAGCATGTTCTAGGATGGTCATCTCATTGACCAGTAAGGAATTAAGTGCCTATTCC
AAAGCTGGGGCTGTGGCAGAAGAAGTCTTGTCATCAATCCGAACAGTCATAGCCTTTAGG
GCCCAGGAGAAAGAACTTCAAAGGTATACACAGAATCTCAAAGATGCAAAGGATTTTGGC
ATAAAAAGGACTATAGCTTCAAAAGTGTCTCTTGGTGCTGTGTACTTCTTTATGAATGGA
ACCTATGGACTTGCTTTTTGGTATGGAACCTCCTTGATTCTTAATGGAGAACCTGGATAT
ACCATCGGGACTGTTCTTGCTGTTTTCTTTAGTGTAATCCATAGCAGTTATTGCATTGGA
GCAGCAGTCCCTCACTTTGAAACCTTCGCAATAGCCCGAGGAGCTGCCTTTCATATTTTC
CAGGTTATTGATAAGAAACCCAGTATAGATAACTTTTCCACAGCTGGATATAAACCTGAA
TCCATAGAAGGAACTGTGGAATTTAAAAATGTTTCTTTCAATTATCCATCAAGACCATCT
ATCAAGATTCTGAAAGGTCTGAATCTCAGAATTAAGTCTGGAGAGACAGTCGCCTTGGTC
GGTCTCAATGGCAGTGGGAAGAGTACGGTAGTCCAGCTTCTGCAGAGGTTATATGATCCG
GATGATGGCTTTATCATGGTGGATGAGAATGACATCAGAGCTTTAAATGTGCGGCATTAT
CGAGACCATATTGGAGTGGTTAGTCAAGAGCCTGTTTTGTTCGGGACCACCATCAGTAAC
AATATCAAGTATGGACGAGATGATGTGACTGATGAAGAGATGGAGAGAGCAGCAAGGGAA
GCAAATGCGTATGATTTTATCATGGAGTTTCCTAATAAATTTAATACATTGGTAGGGGAA
AAAGGAGCTCAAATGAGTGGAGGGCAGAAACAGAGGATCGCAATTGCTCGTGCCTTAGTT
CGAAACCCCAAGATTCTGATTTTAGATGAGGCTACGTCTGCCCTGGATTCAGAAAGCAAG
TCAGCTGTTCAAGCTGCACTGGAGAAGGCGAGCAAAGGTCGGACTACAATCGTGGTAGCA
CACCGACTTTCTACTATTCGAAGTGCAGATTTGATTGTGACCCTAAAGGATGGAATGCTG
GCGGAGAAAGGAGCACATGCTGAACTAATGGCAAAACGAGGTCTATATTATTCACTTGTG
ATGTCACAGGATATTAAAAAAGCTGATGAACAGATGGAGTCAATGACATATTCTACTGAA
AGAAAGACCAACTCACTTCCTCTGCACTCTGTGAAGAGCATCAAGTCAGACTTCATTGAC
AAGGCTGAGGAATCCACCCAATCTAAAGAGATAAGTCTTCCTGAAGTCTCTCTATTAAAA
ATTTTAAAGTTAAACAAGCCTGAATGGCCTTTTGTGGTTCTGGGGACATTGGCTTCTGTT
CTAAATGGAACTGTTCATCCAGTATTTTCCATCATCTTTGCAAAAATTATAACCATGTTT
GGAAATAATGATAAAACCACATTAAAGCATGATGCAGAAATTTATTCCATGATATTCGTC
ATTTTGGGTGTTATTTGCTTTGTCAGTTATTTCATGCAGGGATTATTTTACGGCAGAGCA
GGGGAAATTTTAACGATGAGATTAAGACACTTGGCCTTCAAAGCCATGTTATATCAGGAT
ATTGCCTGGTTTGATGAAAAGGAAAACAGCACAGGAGGCTTGACAACAATATTAGCCATA
GATATAGCACAAATTCAAGGAGCAACAGGTTCCAGGATTGGCGTCTTAACACAAAATGCA
ACTAACATGGGACTTTCAGTTATCATTTCCTTTATATATGGATGGGAGATGACATTCCTG
ATTCTGAGTATTGCTCCAGTACTTGCCGTGACAGGAATGATTGAAACCGCAGCAATGACT
GGATTTGCCAACAAAGATAAGCAAGAACTTAAGCATGCTGGAAAGATAGCAACTGAAGCT
TTGGAGAATATACGTACTATAGTGTCATTAACAAGGGAAAAAGCCTTCGAGCAAATGTAT
GAAGAGATGCTTCAGACTCAACACAGAAATACCTCGAAGAAAGCACAGATTATTGGAAGC
TGTTATGCATTCAGCCATGCCTTTATATATTTTGCCTATGCGGCAGGGTTTCGATTTGGA
GCCTATTTAATTCAAGCTGGACGAATGACCCCAGAGGGCATGTTCATAGTTTTTACTGCA
ATTGCATATGGAGCTATGGCCATCGGAGAAACGCTCGTTTTGGCTCCTGAATATTCCAAA
GCCAAATCGGGGGCTGCGCATCTGTTTGCCTTGTTGGAAAAGAAACCAAATATAGACAGC
CGCAGTCAAGAAGGGAAAAAGCCAGACACATGTGAAGGGAATTTAGAGTTTCGAGAAGTC
TCTTTCTTCTATCCATGTCGCCCAGATGTTTTCATCCTCCGTGGCTTATCCCTCAGTATT
GAGCGAGGAAAGACAGTAGCATTTGTGGGGAGCAGCGGCTGTGGGAAAAGCACTTCTGTT
CAACTTCTGCAGAGACTTTATGACCCCGTGCAAGGACAAGTGCTGTTTGATGGTGTGGAT
GCAAAAGAATTGAATGTACAGTGGCTCCGTTCCCAAATAGCAATCGTTCCTCAAGAGCCT
GTGCTCTTCAACTGCAGCATTGCTGAGAACATCGCCTATGGTGACAACAGCCGTGTGGTG
CCATTAGATGAGATCAAAGAAGCCGCAAATGCAGCAAATATCCATTCTTTTATTGAAGGT
CTCCCTGAGAAATACAACACACAAGTTGGACTGAAAGGAGCACAGCTTTCTGGCGGCCAG
AAACAAAGACTAGCTATTGCAAGGGCTCTTCTCCAAAAACCCAAAATTTTATTGTTGGAT
GAGGCCACTTCAGCCCTCGATAATGACAGTGAGAAGGTGGTTCAGCATGCCCTTGATAAA
GCCAGGACGGGAAGGACATGCCTAGTGGTCACTCACAGGCTCTCTGCAATTCAGAACGCA
GATTTGATAGTGGTTCTGCACAATGGAAAGATAAAGGAACAAGGAACTCATCAAGAGCTC
CTGAGAAATCGAGACATATATTTTAAGTTAGTGAATGCACAGTCAGTGCAGTGA
Chromosome Location
7
Locus
7p15.3
External Identifiers
ResourceLink
UniProtKB IDQ2M3G0
UniProtKB Entry NameABCB5_HUMAN
GenBank Gene IDAY090613
GenAtlas IDABCB5
HGNC IDHGNC:46
General References
  1. Frank NY, Pendse SS, Lapchak PH, Margaryan A, Shlain D, Doeing C, Sayegh MH, Frank MH: Regulation of progenitor cell fusion by ABCB5 P-glycoprotein, a novel human ATP-binding cassette transporter. J Biol Chem. 2003 Nov 21;278(47):47156-65. Epub 2003 Sep 7. [PubMed:12960149]
  2. Chen KG, Szakacs G, Annereau JP, Rouzaud F, Liang XJ, Valencia JC, Nagineni CN, Hooks JJ, Hearing VJ, Gottesman MM: Principal expression of two mRNA isoforms (ABCB 5alpha and ABCB 5beta ) of the ATP-binding cassette transporter gene ABCB 5 in melanoma cells and melanocytes. Pigment Cell Res. 2005 Apr;18(2):102-12. [PubMed:15760339]
  3. Wilson BJ, Schatton T, Zhan Q, Gasser M, Ma J, Saab KR, Schanche R, Waaga-Gasser AM, Gold JS, Huang Q, Murphy GF, Frank MH, Frank NY: ABCB5 identifies a therapy-refractory tumor cell population in colorectal cancer patients. Cancer Res. 2011 Aug 1;71(15):5307-16. doi: 10.1158/0008-5472.CAN-11-0221. Epub 2011 Jun 7. [PubMed:21652540]
  4. Kawanobe T, Kogure S, Nakamura S, Sato M, Katayama K, Mitsuhashi J, Noguchi K, Sugimoto Y: Expression of human ABCB5 confers resistance to taxanes and anthracyclines. Biochem Biophys Res Commun. 2012 Feb 24;418(4):736-41. doi: 10.1016/j.bbrc.2012.01.090. Epub 2012 Jan 28. [PubMed:22306008]
  5. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948]
  6. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  8. Huang Y, Anderle P, Bussey KJ, Barbacioru C, Shankavaram U, Dai Z, Reinhold WC, Papp A, Weinstein JN, Sadee W: Membrane transporters and channels: role of the transportome in cancer chemosensitivity and chemoresistance. Cancer Res. 2004 Jun 15;64(12):4294-301. [PubMed:15205344]
  9. Frank NY, Margaryan A, Huang Y, Schatton T, Waaga-Gasser AM, Gasser M, Sayegh MH, Sadee W, Frank MH: ABCB5-mediated doxorubicin transport and chemoresistance in human malignant melanoma. Cancer Res. 2005 May 15;65(10):4320-33. [PubMed:15899824]
  10. Grimm M, Krimmel M, Polligkeit J, Alexander D, Munz A, Kluba S, Keutel C, Hoffmann J, Reinert S, Hoefert S: ABCB5 expression and cancer stem cell hypothesis in oral squamous cell carcinoma. Eur J Cancer. 2012 Nov;48(17):3186-97. doi: 10.1016/j.ejca.2012.05.027. Epub 2012 Jul 10. [PubMed:22784549]
  11. Yang M, Li W, Fan D, Yan Y, Zhang X, Zhang Y, Xiong D: Expression of ABCB5 gene in hematological malignances and its significance. Leuk Lymphoma. 2012 Jun;53(6):1211-5. doi: 10.3109/10428194.2011.637214. Epub 2011 Dec 7. [PubMed:22044138]
  12. Chartrain M, Riond J, Stennevin A, Vandenberghe I, Gomes B, Lamant L, Meyer N, Gairin JE, Guilbaud N, Annereau JP: Melanoma chemotherapy leads to the selection of ABCB5-expressing cells. PLoS One. 2012;7(5):e36762. doi: 10.1371/journal.pone.0036762. Epub 2012 May 24. [PubMed:22675422]
  13. Lin JY, Zhang M, Schatton T, Wilson BJ, Alloo A, Ma J, Qureshi AA, Frank NY, Han J, Frank MH: Genetically determined ABCB5 functionality correlates with pigmentation phenotype and melanoma risk. Biochem Biophys Res Commun. 2013 Jul 5;436(3):536-42. doi: 10.1016/j.bbrc.2013.06.006. Epub 2013 Jun 12. [PubMed:23770371]
  14. Wilson BJ, Saab KR, Ma J, Schatton T, Putz P, Zhan Q, Murphy GF, Gasser M, Waaga-Gasser AM, Frank NY, Frank MH: ABCB5 maintains melanoma-initiating cells through a proinflammatory cytokine signaling circuit. Cancer Res. 2014 Aug 1;74(15):4196-207. doi: 10.1158/0008-5472.CAN-14-0582. Epub 2014 Jun 16. [PubMed:24934811]
  15. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]
  16. Jones S, Zhang X, Parsons DW, Lin JC, Leary RJ, Angenendt P, Mankoo P, Carter H, Kamiyama H, Jimeno A, Hong SM, Fu B, Lin MT, Calhoun ES, Kamiyama M, Walter K, Nikolskaya T, Nikolsky Y, Hartigan J, Smith DR, Hidalgo M, Leach SD, Klein AP, Jaffee EM, Goggins M, Maitra A, Iacobuzio-Donahue C, Eshleman JR, Kern SE, Hruban RH, Karchin R, Papadopoulos N, Parmigiani G, Vogelstein B, Velculescu VE, Kinzler KW: Core signaling pathways in human pancreatic cancers revealed by global genomic analyses. Science. 2008 Sep 26;321(5897):1801-6. doi: 10.1126/science.1164368. Epub 2008 Sep 4. [PubMed:18772397]
  17. Ksander BR, Kolovou PE, Wilson BJ, Saab KR, Guo Q, Ma J, McGuire SP, Gregory MS, Vincent WJ, Perez VL, Cruz-Guilloty F, Kao WW, Call MK, Tucker BA, Zhan Q, Murphy GF, Lathrop KL, Alt C, Mortensen LJ, Lin CP, Zieske JD, Frank MH, Frank NY: ABCB5 is a limbal stem cell gene required for corneal development and repair. Nature. 2014 Jul 17;511(7509):353-7. doi: 10.1038/nature13426. Epub 2014 Jul 2. [PubMed:25030174]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04851BiricodarinvestigationalunknownDetails
DB09183DasabuvirapprovednosubstrateDetails
DB11943Delafloxacinapproved, investigationalnosubstrateDetails
DB11591Bilastineapproved, investigationalunknownsubstrateinhibitorDetails
DB11691Naldemedineapproved, investigationalnosubstrateDetails
DB12267Brigatinibapproved, investigationalnosubstrateinhibitorDetails
DB11641Vinflunineapproved, investigationalnosubstrateDetails
DB06263AmrubicininvestigationalunknownsubstrateDetails
DB08870Brentuximab vedotinapproved, investigationalunknownsubstrateDetails
DB12010Fostamatinibapproved, investigationalnosubstrateDetails
DB04948Lofexidineapproved, investigationalnoinhibitorDetails
DB14067Dofequidarexperimental, investigationalunknowninhibitorDetails
DB13997Baloxavir marboxilapproved, investigationalunknownsubstrateDetails
DB00254Doxycyclineapproved, investigational, vet_approvedunknowninducerDetails
DB00598LabetalolapprovedunknownDetails