Myosin light chain kinase 3

Details

Name
Myosin light chain kinase 3
Synonyms
  • 2.7.11.18
  • Cardiac-MLCK
  • Cardiac-MyBP-C-associated Ca/CaM kinase
  • MLCK
Gene Name
MYLK3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0051864|Myosin light chain kinase 3
MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHL
ERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAA
VDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGV
QSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHL
PLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEVAPGAGQGASSSRPDPEPLEE
GTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLMTGRGSLGPTL
TTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRMPPGA
EAGSVVLDDSPAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLP
LAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLA
RRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAET
MNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKASRS
KTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP
Number of residues
819
Molecular Weight
88392.24
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / calmodulin-dependent protein kinase activity / myosin light chain kinase activity
Processes
cardiac myofibril assembly / cellular response to interleukin-1 / intracellular signal transduction / peptidyl-serine phosphorylation / peptidyl-threonine phosphorylation / positive regulation of sarcomere organization / protein phosphorylation / regulation of vascular permeability involved in acute inflammatory response / sarcomere organization / sarcomerogenesis
Components
actin cytoskeleton / cytoplasm / cytosol / intracellular
General Function
Kinase that phosphorylates MYL2 in vitro. Promotes sarcomere formation in cardiomyocytes and increases cardiomyocyte contractility (By similarity).
Specific Function
Atp binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0051865|Myosin light chain kinase 3 (MYLK3)
ATGTCAGGAACCTCCAAGGAGAGTCTGGGGCATGGGGGGCTGCCAGGGTTGGGCAAGACC
TGCTTAACAACCATGGACACAAAGCTGAACATGCTGAACGAGAAGGTGGACCAGCTCCTG
CACTTCCAAGAAGATGTCACAGAGAAGTTGCAGAGCATGTGCCGAGACATGGGCCACCTG
GAGCGGGGCCTGCACAGGCTGGAGGCCTCCCGGGCACCGGGCCCGGGCGGGGCTGATGGG
GTTCCCCACATTGACACCCAGGCTGGGTGGCCCGAGGTCCTGGAGCTGGTGAGGGCCATG
CAGCAGGATGCGGCCCAGCACGGTGCCAGGCTGGAGGCCCTCTTCAGGATGGTGGCTGCG
GTGGACAGGGCCATCGCTTTGGTGGGGGCCACGTTCCAGAAATCAAAGGTGGCGGATTTC
CTCATGCAGGGGCGTGTGCCCTGGAGGAGAGGCAGCCCAGGTGACAGCCCTGAGGAGAAT
AAAGAGCGAGTGGAAGAAGAGGGAGGAAAACCAAAGCATGTGCTGAGCACCAGTGGGGTG
CAGTCTGATGCCAGGGAGCCTGGGGAAGAGAGCCAGAAGGCGGACGTGCTGGAGGGGACA
GCGGAGAGGCTGCCCCCCATCAGAGCGTCAGGGCTGGGAGCTGACCCCGCCCAGGCAGTG
GTCTCACCGGGCCAGGGAGATGGTGTTCCTGGCCCAGCCCAGGCATTCCCTGGCCACCTG
CCCCTGCCCACAAAGGTGGAAGCCAAGGCTCCTGAGACACCCAGCGAGAACCTCAGGACT
GGCCTGGAATTGGCTCCAGCACCCGGCAGGGTCAATGTGGTCTCCCCGAGCCTGGAGGTT
GCACCAGGTGCAGGACAAGGAGCATCGTCCAGCAGGCCTGACCCTGAGCCCTTAGAGGAA
GGCACGAGGCTGACTCCAGGGCCTGGCCCTCAGTGCCCAGGGCCTCCAGGGCTGCCAGCC
CAGGCCAGGGCAACCCACAGTGGTGGAGAAACACCTCCAAGGATCTCCATCCACATACAA
GAGATGGATACTCCTGGGGAGATGCTGATGACAGGCAGGGGCAGCCTTGGACCCACCCTC
ACCACAGAGGCTCCAGCAGCTGCCCAGCCAGGCAAGCAGGGCCCACCTGGGACCGGGCGC
TGCCTCCAAGCCCCTGGGACTGAGCCCGGAGAACAGACCCCTGAAGGAGCCAGAGAGCTC
TCCCCGCTGCAGGAGAGCAGCAGCCCCGGGGGAGTGAAGGCAGAGGAGGAGCAAAGGGCT
GGGGCCGAGCCTGGCACGAGACCAAGCTTGGCCAGGAGTGACGACAATGACCACGAGGTT
GGGGCCCTGGGCCTGCAGCAGGGCAAAAGCCCAGGGGCGGGAAACCCTGAGCCTGAGCAG
GACTGTGCAGCCAGGGCTCCGGTGAGAGCTGAAGCAGTAAGGAGGATGCCCCCAGGCGCC
GAGGCTGGCAGCGTGGTTCTGGATGACAGTCCGGCCCCACCAGCTCCTTTTGAACACCGG
GTAGTGAGCGTCAAGGAGACCTCCATCTCTGCGGGTTACGAGGTGTGCCAGCACGAAGTC
TTGGGAGGGGGTCGGTTTGGCCAGGTCCACAGGTGCACAGAGAAGTCCACAGGCCTCCCA
CTGGCTGCCAAGATCATCAAAGTGAAGAGCGCCAAGGACCGGGAGGACGTGAAGAACGAG
ATCAACATCATGAACCAGCTCAGCCACGTGAACCTGATCCAGCTCTATGACGCCTTCGAG
AGCAAGCACAGCTGCACCCTTGTCATGGAGTACGTGGACGGGGGTGAGCTCTTCGACCGG
ATCACAGATGAGAAGTACCACCTGACTGAGCTGGATGTGGTCCTGTTCACCAGGCAGATC
TGTGAGGGTGTGCATTACCTGCACCAGCACTACATCCTGCACCTGGACCTCAAGCCGGAG
AACATATTGTGCGTCAATCAGACAGGACATCAAATTAAGATCATTGACTTTGGGCTGGCC
AGAAGGTACAAGCCTCGAGAGAAGCTGAAGGTGAACTTCGGCACTCCTGAGTTCCTGGCC
CCAGAAGTCGTCAATTATGAGTTTGTCTCATTCCCCACAGACATGTGGAGTGTGGGAGTC
ATCACCTACATGCTACTCAGTGGCTTGTCCCCATTTCTAGGGGAAACAGATGCAGAGACC
ATGAATTTCATTGTAAACTGTAGCTGGGATTTTGATGCTGACACCTTTGAAGGGCTCTCG
GAGGAGGCCAAGGACTTTGTTTCCCGGTTGCTGGTCAAAGAGAAGAGCTGCAGAATGAGT
GCCACACAGTGCCTGAAACACGAGTGGCTGAATAATTTGCCTGCCAAAGCTTCAAGATCC
AAAACTCGTCTCAAATCCCAACTACTGCTGCAGAAATACATAGCTCAAAGAAAATGGAAG
AAACATTTCTATGTGGTGACTGCTGCCAACAGGTTAAGGAAATTTCCAACTTCTCCCTAA
Chromosome Location
16
Locus
16q11.2
External Identifiers
ResourceLink
UniProtKB IDQ32MK0
UniProtKB Entry NameMYLK3_HUMAN
HGNC IDHGNC:29826
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  2. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [PubMed:19054851]
  3. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Seguchi O, Takashima S, Yamazaki S, Asakura M, Asano Y, Shintani Y, Wakeno M, Minamino T, Kondo H, Furukawa H, Nakamaru K, Naito A, Takahashi T, Ohtsuka T, Kawakami K, Isomura T, Kitamura S, Tomoike H, Mochizuki N, Kitakaze M: A cardiac myosin light chain kinase regulates sarcomere assembly in the vertebrate heart. J Clin Invest. 2007 Oct;117(10):2812-24. [PubMed:17885681]
  6. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [PubMed:23186163]
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails