3,4-dihydroxyphenylacetate 2,3-dioxygenase

Details

Name
3,4-dihydroxyphenylacetate 2,3-dioxygenase
Synonyms
Not Available
Gene Name
mndD
Organism
Arthrobacter globiformis
Amino acid sequence
>lcl|BSEQ0021997|3,4-dihydroxyphenylacetate 2,3-dioxygenase
MTNFVPTPSVPAPDIVRCAYMEIVVTDLAKSREFYVDVLGLHVTEEDENTIYLRSLEEFI
HHNLVLRQGPIAAVAAFAYRVKSPAEVDAAEAYYKELGCRTERRKEGFTKGIGDSVRVED
PLGFPYEFFYETEHVERLTQRYDLYSAGELVRLDHFNQVTPDVPRGRAYLEDLGFRVSED
IKDSDGVTYAAWMHRKQTVHDTALTGGNGPRMHHVAFATHEKHNIIQICDKMRPCASATG
SNGPRPAPVSNAFYLYILDPDGHRIEIYTQDYYTGDPDNPTITWDVHDNQRRDWWGNPVV
PSWYTEASLVLDLDGNPQPVIVREEKSEMAVTVGAEPSPTPAR
Number of residues
343
Molecular Weight
38861.14
Theoretical pI
4.88
GO Classification
Functions
dioxygenase activity / metal ion binding
General Function
Metal ion binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0004928|1032 bp
ATGACCAACTTCGTTCCCACCCCCTCTGTCCCGGCACCGGATATCGTCCGCTGCGCCTAC
ATGGAGATCGTGGTCACGGACCTCGCCAAGTCGCGCGAGTTCTACGTGGACGTCCTGGGC
CTGCACGTCACCGAAGAGGATGAAAACACCATCTACCTCCGCTCCCTGGAGGAGTTCATC
CACCACAACCTGGTACTCCGCCAGGGACCCATCGCCGCCGTCGCAGCCTTCGCCTACCGG
GTGAAGTCCCCCGCCGAGGTGGATGCCGCCGAGGCGTACTACAAGGAGCTGGGCTGCCGC
ACCGAGCGCCGCAAGGAAGGCTTCACCAAGGGCATCGGCGACTCCGTCCGCGTCGAGGAC
CCGCTGGGCTTCCCCTACGAGTTCTTCTACGAGACCGAGCACGTGGAGCGCCTCACCCAG
CGCTACGACCTCTACTCCGCCGGTGAACTGGTGCGCCTGGACCACTTCAACCAGGTCACC
CCGGACGTTCCCCGCGGCCGGGCGTACCTGGAGGACCTCGGCTTCCGCGTCTCCGAAGAC
ATCAAGGACTCCGACGGCGTCACCTACGCCGCCTGGATGCACCGCAAGCAGACCGTGCAC
GACACCGCCCTGACCGGCGGCAACGGCCCGCGCATGCACCACGTCGCGTTCGCCACGCAC
GAGAAGCACAACATCATCCAGATCTGCGACAAGATGCGGCCCTGCGCATCAGCGACCGGA
TCGAACGGCCCCCGGCCGGCACCGGTCTCCAACGCCTTCTACCTCTACATCCTGGACCCG
GACGGCCACCGCATCGAGATCTACACCCAGGACTACTACACCGGCGACCCGGACAACCCC
ACCATCACCTGGGACGTCCACGACAACCAGCGCCGCGACTGGTGGGGCAACCCCGTGGTC
CCGTCCTGGTACACCGAGGCCTCCCTGGTCCTGGACCTGGACGGCAACCCGCAGCCGGTC
ATCGTCCGCGAGGAAAAGTCCGAAATGGCCGTGACCGTCGGAGCCGAGCCTTCTCCTACA
CCCGCAAGATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ44048
UniProtKB Entry NameQ44048_ARTGO
GenBank Gene IDU19817
General References
  1. Vetting MW, Wackett LP, Que L Jr, Lipscomb JD, Ohlendorf DH: Crystallographic comparison of manganese- and iron-dependent homoprotocatechuate 2,3-dioxygenases. J Bacteriol. 2004 Apr;186(7):1945-58. [PubMed:15028678]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB017022-(3,4-Dihydroxyphenyl)Acetic AcidexperimentalunknownDetails