Cell division protein

Details

Name
Cell division protein
Synonyms
  • ftsI
  • ftsI_1
  • ftsI_2
  • Penicillin-binding protein 3
  • Peptidoglycan synthase FtsI
Gene Name
pbpB
Organism
Pseudomonas aeruginosa
Amino acid sequence
>lcl|BSEQ0022449|Cell division protein
MKLNYFQGALYPWRFCVIVGLLLAMVGAIVWRIVDLHVIDHDFLKGQGDARSVRHIAIPA
HRGLITDRNGEPLAVSTPVTTLWANPKELMTAKERWPQLAAALGQDTKLFADRIEQNAER
EFIYLVRGLTPEQGEGVIALKVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIEL
AFDEWLAGVPGKRQVLKDRRGRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALL
ENGAKAGSLVIMDVKTGEILAMTNQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFS
MSAALASGRWKPSDIVDVYPGTLQIGRYTIRDVSRNSRQLDLTGILIKSSNVGISKIAFD
IGAESIYSVMQQVGLGQDTGLGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAH
AYAALANDGKSVPLSMTRVDRVPDGVQVISPEVASTVQGMLQQVVEAQGGVFRAQVPGYH
AAGKSGTARKVSVGTKGYRENAYRSLFAGFAPATDPRIAMVVVIDEPSKAGYFGGLVSAP
VFSKVMAGALRLMNVPPDNLPTATEQQQVNAAPAKGGRG
Number of residues
579
Molecular Weight
62855.78
Theoretical pI
Not Available
GO Classification
Functions
penicillin binding / peptidoglycan glycosyltransferase activity
Processes
cell division
Components
integral component of membrane
General Function
Peptidoglycan glycosyltransferase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
12-34
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0022450|Cell division protein (pbpB)
ATGAAACTGAATTATTTCCAGGGCGCCCTCTACCCATGGCGGTTCTGCGTGATCGTCGGC
CTGCTGCTGGCGATGGTCGGCGCCATCGTCTGGCGAATCGTCGACCTGCACGTGATCGAC
CATGACTTCCTCAAGGGCCAGGGCGACGCGCGTAGCGTGCGGCATATCGCCATCCCTGCG
CACCGGGGCCTGATCACTGACCGCAACGGCGAACCGCTGGCGGTGAGCACCCCGGTCACC
ACCCTGTGGGCCAACCCCAAGGAGCTGATGACCGCCAAGGAACGCTGGCCGCAACTGGCG
GCGGCGCTCGGGCAGGATACCAAGCTGTTCGCCGACCGCATCGAGCAGAACGCCGAGCGC
GAGTTCATCTATCTGGTCCGTGGGCTGACCCCGGAGCAGGGCGAAGGCGTGATCGCCCTG
AAGGTGCCCGGCGTGTACTCCATCGAGGAGTTTCGGCGTTTCTACCCGGCTGGCGAAGTG
GTGGCCCATGCGGTCGGCTTTACCGATGTCGACGACCGCGGTCGCGAAGGTATCGAGCTG
GCTTTCGACGAATGGCTGGCCGGCGTGCCGGGCAAGCGCCAGGTGCTCAAGGATCGCCGT
GGCCGCGTGATCAAGGACGTGCAGGTCACCAAGAATGCCAAACCGGGCAAGACCCTTGCG
CTGTCCATCGACCTGCGCCTGCAGTACCTGGCTCATCGCGAACTGCGCAACGCTCTGCTG
GAAAACGGCGCCAAGGCCGGCAGCTTGGTGATCATGGACGTGAAGACCGGGGAGATCCTG
GCCATGACCAACCAGCCCACCTACAACCCGAACAATCGTCGTAACCTGCAGCCGGCGGCC
ATGCGCAACCGGGCGATGATCGACGTGTTCGAGCCGGGCTCGACGGTCAAGCCGTTCTCG
ATGAGCGCGGCGCTGGCCAGCGGGCGCTGGAAACCCAGCGATATCGTCGACGTCTACCCG
GGCACCCTGCAGATCGGCCGCTACACCATTCGCGACGTATCGCGCAATTCGCGGCAACTC
GATCTCACCGGCATCCTGATCAAGTCGAGCAACGTCGGCATCAGCAAGATCGCCTTCGAC
ATCGGCGCCGAATCCATCTACTCGGTCATGCAACAGGTCGGTCTCGGGCAGGACACGGGG
TTGGGCTTCCCCGGCGAGCGCGTCGGCAACCTGCCCAACCACCGCAAGTGGCCGAAGGCG
GAAACCGCGACCCTGGCCTACGGCTACGGTCTCTCGGTAACCGCGATCCAGTTGGCGCAT
GCCTATGCGGCCCTGGCCAACGACGGCAAGAGCGTGCCGCTGAGCATGACCCGAGTCGAC
CGCGTGCCGGATGGTGTGCAGGTGATCTCGCCTGAAGTGGCTTCCACCGTGCAGGGCATG
CTGCAACAAGTGGTCGAGGCCCAGGGCGGGGTGTTCCGCGCCCAGGTGCCGGGTTACCAC
GCCGCCGGCAAGAGCGGGACCGCGCGCAAGGTCTCGGTCGGCACCAAGGGCTACCGGGAA
AACGCCTATCGCTCGCTGTTCGCCGGTTTCGCCCCGGCCACCGATCCGCGCATCGCGATG
GTCGTGGTGATCGACGAGCCGAGCAAGGCGGGCTACTTCGGCGGCCTGGTGTCGGCGCCG
GTGTTCAGTAAGGTCATGGCTGGCGCGCTGCGCCTGATGAACGTGCCGCCGGATAACCTG
CCGACGGCCACCGAACAGCAGCAGGTCAATGCTGCGCCCGCAAAAGGAGGGCGTGGCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ51504
UniProtKB Entry NameQ51504_PSEAI
General References
  1. Liao X, Hancock RE: Cloning and characterization of the Pseudomonas aeruginosa pbpB gene encoding penicillin-binding protein 3. Antimicrob Agents Chemother. 1995 Aug;39(8):1871-4. [PubMed:7486937]
  2. Han S, Zaniewski RP, Marr ES, Lacey BM, Tomaras AP, Evdokimov A, Miller JR, Shanmugasundaram V: Structural basis for effectiveness of siderophore-conjugated monocarbams against clinically relevant strains of Pseudomonas aeruginosa. Proc Natl Acad Sci U S A. 2010 Dec 21;107(51):22002-7. doi: 10.1073/pnas.1013092107. Epub 2010 Dec 6. [PubMed:21135211]
  3. Sainsbury S, Bird L, Rao V, Shepherd SM, Stuart DI, Hunter WN, Owens RJ, Ren J: Crystal structures of penicillin-binding protein 3 from Pseudomonas aeruginosa: comparison of native and antibiotic-bound forms. J Mol Biol. 2011 Jan 7;405(1):173-84. doi: 10.1016/j.jmb.2010.10.024. Epub 2010 Oct 23. [PubMed:20974151]
  4. Mitton-Fry MJ, Arcari JT, Brown MF, Casavant JM, Finegan SM, Flanagan ME, Gao H, George DM, Gerstenberger BS, Han S, Hardink JR, Harris TM, Hoang T, Huband MD, Irvine R, Lall MS, Megan Lemmon M, Li C, Lin J, McCurdy SP, Mueller JP, Mullins L, Niosi M, Noe MC, Pattavina D, Penzien J, Plummer MS, Risley H, Schuff BP, Shanmugasundaram V, Starr JT, Sun J, Winton J, Young JA: Novel monobactams utilizing a siderophore uptake mechanism for the treatment of gram-negative infections. Bioorg Med Chem Lett. 2012 Sep 15;22(18):5989-94. doi: 10.1016/j.bmcl.2012.07.005. Epub 2012 Jul 20. [PubMed:22892121]
  5. Brown MF, Mitton-Fry MJ, Arcari JT, Barham R, Casavant J, Gerstenberger BS, Han S, Hardink JR, Harris TM, Hoang T, Huband MD, Lall MS, Lemmon MM, Li C, Lin J, McCurdy SP, McElroy E, McPherson C, Marr ES, Mueller JP, Mullins L, Nikitenko AA, Noe MC, Penzien J, Plummer MS, Schuff BP, Shanmugasundaram V, Starr JT, Sun J, Tomaras A, Young JA, Zaniewski RP: Pyridone-conjugated monobactam antibiotics with gram-negative activity. J Med Chem. 2013 Jul 11;56(13):5541-52. doi: 10.1021/jm400560z. Epub 2013 Jun 27. [PubMed:23755848]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01413Cefepimeapproved, investigationalyesinhibitorDetails
DB01147Cloxacillinapproved, investigational, vet_approvedyesinhibitorDetails
DB09050Ceftolozaneapproved, investigationalyesinhibitorDetails
DB06211Doripenemapproved, investigationalyesantagonistinhibitorDetails
DB14879Cefiderocolapproved, investigationalyesinhibitorDetails