Cytochrome c4

Details

Name
Cytochrome c4
Synonyms
  • Cytochrome c4 precursor
Gene Name
cc4
Organism
Pseudomonas stutzeri
Amino acid sequence
>lcl|BSEQ0011266|Cytochrome c4
MNKVLVSLLLTLGITGMAHAAGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYL
LKQLQDIKAGSTPGAPEGVGRKVLEMTGMLDPLSDQDLEDIAAYFSSQKGSVGYADPALA
KQGEKLFRGGKLDQGMPACTGCHAPNGVGNDLAGFPKLGGQHAAYTAKQLTDFREGNRTN
DGDTMIMRGVAAKLSNKDIEALSSYIQGLH
Number of residues
210
Molecular Weight
21741.505
Theoretical pI
6.67
GO Classification
Functions
electron carrier activity / heme binding / iron ion binding
Processes
oxidation-reduction process
Components
periplasmic space
General Function
Iron ion binding
Specific Function
Diheme, high potential cytochrome c believed to be an intermediate electron donor to terminal oxidation systems.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Gene sequence
>lcl|BSEQ0003509|633 bp
ATGAACAAAGTACTCGTGAGTCTGCTGTTGACCCTTGGCATCACCGGTATGGCCCACGCG
GCTGGAGACGCCGAAGCTGGTCAGGGCAAAGTTGCAGTGTGTGGTGCGTGCCACGGTGTC
GATGGCAACAGCCCGGCGCCGAATTTCCCGAAACTGGCTGGCCAGGGTGAGCGTTACCTG
CTCAAGCAACTGCAGGACATCAAGGCTGGCAGCACACCGGGTGCCCCGGAAGGCGTAGGT
CGCAAGGTGTTGGAAATGACCGGCATGCTGGACCCGCTGAGTGATCAGGATCTGGAAGAC
ATCGCCGCCTACTTCTCAAGCCAGAAGGGCAGTGTTGGTTACGCCGATCCGGCTCTGGCA
AAGCAGGGCGAGAAACTGTTCCGTGGTGGCAAGCTCGATCAGGGCATGCCGGCGTGCACC
GGTTGCCACGCACCCAACGGCGTCGGTAACGACCTGGCTGGCTTCCCCAAGCTGGGTGGG
CAGCACGCGGCGTACACCGCCAAGCAGCTGACCGACTTCCGCGAAGGCAATCGCACCAAC
GACGGCGACACCATGATCATGCGTGGCGTCGCCGCCAAGCTGAGCAACAAGGACATCGAA
GCGCTGTCCAGCTACATCCAGGGCCTGCACTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ52369
UniProtKB Entry NameCYC4_PSEST
GenBank Protein ID516878
GenBank Gene IDU05988
General References
  1. Christensen HE: Cloning and characterisation of the gene encoding cytochrome c4 from Pseudomonas stutzeri. Gene. 1994 Jun 24;144(1):139-40. [PubMed:8026750]
  2. Kadziola A, Larsen S: Crystal structure of the dihaem cytochrome c4 from Pseudomonas stutzeri determined at 2.2A resolution. Structure. 1997 Feb 15;5(2):203-16. [PubMed:9032080]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails
DB03754TromethamineapprovedunknownDetails
DB09462Glycerinapproved, investigationalunknownDetails