O-methyltransferase

Details

Name
O-methyltransferase
Synonyms
Not Available
Gene Name
Not Available
Organism
Synechocystis sp. (strain PCC 6803 / Kazusa)
Amino acid sequence
>lcl|BSEQ0012642|O-methyltransferase
MGKGITGFDPSLYSYLQSISADDSFYLAQLRRETAHLPGAPMQISPEQAQFLGLLISLTG
AKQVLEIGVFRGYSALAMALQLPPDGQIIACDQDPNATAIAKKYWQKAGVAEKISLRLGP
ALATLEQLTQGKPLPEFDLIFIDADKRNYPRYYEIGLNLLRRGGLMVIDNVLWHGKVTEV
DPQEAQTQVLQQFNRDLAQDERVRISVIPLGDGMTLALKK
Number of residues
220
Molecular Weight
24312.805
Theoretical pI
5.83
GO Classification
Functions
metal ion binding / O-methyltransferase activity
General Function
O-methyltransferase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0007258|558 bp
GTGGGGCGTTTGGATCAAGATAGCGAAGGACTATTGCTGCTCACCAGCAACGGTAAACTT
CAGCATCGTTTGGCCCACCGGGAGTTTGCCCACCAACGTACTTATTTTGCCCAAGTAGAA
GGCTCTCCAACGGACGAAGACCTAGAACCCCTGCGGCGGGGCATAACTTTCGCGGATTAC
CCTACCAGACCGGCGATCGCCAAAATTATCACTGAACCAGATTTTCCCCCCAGAAATCCT
CCCATTCGTTATCGAGCCTCCATTCCCACCAGTTGGTTAAGCATTACCCTAACGGAGGGG
CGCAATCGTCAGGTACGTCGAATGACAGCGGCAGTGGGCTTCCCTACCCTACGATTGGTG
CGGGTGCAAATACAGGTTACTGGTCGCTCTCCCCAACAGGGCAAAGGTAAGTCAGCAGCA
ACTTGGTGCTTAACCCTAGAAGGTTTGAGTCCGGGGCAATGGCGACCCCTGACCCCTTGG
GAAGAAAATTTTTGCCAGCAACTCTTAACGGGAAATCCCAATGGTCCCTGGCAGAAAAAA
TTTGGCGATCGCCGTTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ55813
UniProtKB Entry NameQ55813_SYNY3
GenBank Protein ID14595182
GenBank Gene IDBA000022
General References
  1. Kopycki JG, Stubbs MT, Brandt W, Hagemann M, Porzel A, Schmidt J, Schliemann W, Zenk MH, Vogt T: Functional and structural characterization of a cation-dependent O-methyltransferase from the cyanobacterium Synechocystis sp. strain PCC 6803. J Biol Chem. 2008 Jul 25;283(30):20888-96. doi: 10.1074/jbc.M801943200. Epub 2008 May 23. [PubMed:18502765]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB07109(2E)-3-(3-hydroxy-4-methoxyphenyl)prop-2-enoic acidexperimentalunknownDetails
DB07767Ferulic acidexperimentalunknownDetails