Uracil phosphoribosyltransferase

Details

Name
Uracil phosphoribosyltransferase
Synonyms
  • 2.4.2.9
  • UMP pyrophosphorylase
  • UPRTase
Gene Name
upp
Organism
Geobacillus kaustophilus (strain HTA426)
Amino acid sequence
>lcl|BSEQ0016622|Uracil phosphoribosyltransferase
MGKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIETPVS
KARAKVIAGKKLGVIPILRAGIGMVDGILKLIPAAKVGHIGLYRDPQTLKPVEYYVKLPS
DVEERDFIIVDPMLATGGSAVAAIDALKKRGAKSIKFMCLIAAPEGVKAVETAHPDVDIY
IAALDERLNDHGYIVPGLGDAGDRLFGTK
Number of residues
209
Molecular Weight
22831.48
Theoretical pI
6.69
GO Classification
Functions
GTP binding / magnesium ion binding / uracil phosphoribosyltransferase activity
Processes
UMP salvage / uracil salvage
General Function
Uracil phosphoribosyltransferase activity
Specific Function
Catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0016623|Uracil phosphoribosyltransferase (upp)
ATGGGAAAAGTGTACGTCTTTGATCATCCGCTCATCCAGCATAAATTGACCTACATTCGC
GACAAGAATACGGGCACGAAAGAATTTCGCGAGCTTGTCGACGAAGTGGCGACGTTGATG
GCGTTTGAAATTACACGCGATCTGCCGCTTGAGGAAGTCGAGATCGAAACCCCCGTCAGT
AAAGCTAGAGCGAAAGTGATCGCCGGCAAAAAACTGGGCGTCATTCCGATTTTGCGCGCC
GGCATCGGCATGGTTGACGGCATCCTGAAGCTCATCCCGGCGGCGAAAGTCGGCCATATC
GGCTTGTACCGCGATCCCCAAACATTAAAGCCGGTCGAATATTACGTCAAGCTGCCGAGC
GATGTCGAAGAGCGCGATTTTATCATCGTCGACCCGATGCTCGCAACCGGCGGATCAGCG
GTGGCGGCGATCGATGCGCTGAAAAAGCGGGGAGCGAAAAGCATTAAATTTATGTGCCTG
ATCGCGGCGCCGGAAGGAGTCAAAGCGGTGGAAACGGCCCACCCGGATGTGGACATTTAC
ATCGCTGCCCTTGATGAGCGGTTGAACGACCACGGCTATATTGTCCCTGGTCTCGGCGAC
GCCGGCGACCGGCTGTTTGGCACAAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ5KUI3
UniProtKB Entry NameUPP_GEOKA
GenBank Protein ID56381745
GenBank Gene IDBA000043
General References
  1. Takami H, Takaki Y, Chee GJ, Nishi S, Shimamura S, Suzuki H, Matsui S, Uchiyama I: Thermoadaptation trait revealed by the genome sequence of thermophilic Geobacillus kaustophilus. Nucleic Acids Res. 2004 Dec 1;32(21):6292-303. Print 2004. [PubMed:15576355]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03685Uridine monophosphateexperimentalunknownDetails