Nonstructural protein 5A

Details

Name
Nonstructural protein 5A
Synonyms
Not Available
Gene Name
NS5A
Organism
Hepatitis C Virus
Amino acid sequence
>lcl|BSEQ0022270|Nonstructural protein 5A
SGSWLRDVWDWICTVLTDFKTWLQSKLLPRIPGVPFLSCQRGYKGVWRGDGIMHTTCPCG
AQITGHVKNGSMRIVGPKTCSNTWHGTFPINTYTTGPCTPSPAPNYSRALWRVAAEEYVE
VTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFMVGLN
QYLVGSQLPCEPEPDVTVLTSMLTDPSHITAETAGRRLARGSPPSLASSSASQLSAPSLK
ATCTTRHDSPDADLIEANLLWRQEMGGNITRVESENKVVILDSFDPLQAEEDEREVSVPA
EILRKSRKFPRAMPIWARPDYNPPLLESWKDPDYVPPVVHGCPLPPAKAPPIPPPRRKRT
VVLTESTVSSALAELATKTFGSSGSSAVDSGTATAPPDQLPGDGDSGSDVESYSSMPPLE
GEPGDPDLSDGSWSTMSEEASEDVVCC
Number of residues
447
Molecular Weight
48598.34
Theoretical pI
Not Available
GO Classification
Functions
cysteine-type endopeptidase activity / nucleoside-triphosphatase activity / RNA-directed RNA polymerase activity / serine-type endopeptidase activity / zinc ion binding
General Function
Zinc ion binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ5L478
UniProtKB Entry NameQ5L478_9HEPC
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09027LedipasvirapprovedyesinhibitorDetails
DB09296Ombitasvirapproved, investigationalyesinhibitorDetails