30S ribosomal protein S10

Details

Name
30S ribosomal protein S10
Synonyms
Not Available
Gene Name
rpsJ
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Amino acid sequence
>lcl|BSEQ0012555|30S ribosomal protein S10
MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSR
EHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR
Number of residues
105
Molecular Weight
11929.82
Theoretical pI
11.72
GO Classification
Functions
rRNA binding / structural constituent of ribosome / tRNA binding
Processes
translation
Components
ribosome
General Function
Trna binding
Specific Function
Part of the top of the 30S subunit head.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012556|30S ribosomal protein S10 (rpsJ)
ATGCCCAAGATCCGCATCAAGCTCCGGGGTTTTGACCACAAGACCCTGGACGCCTCGGCC
CAGAAGATCGTGGAGGCGGCCCGGCGTTCCGGGGCCCAGGTCTCCGGCCCCATCCCCCTA
CCCACCCGGGTGCGCCGCTTCACCGTGATCCGGGGGCCCTTCAAGCACAAGGACTCCCGG
GAGCACTTTGAGCTGCGCACCCACAACCGGCTTGTGGACATCATCAACCCCAACCGGAAG
ACCATTGAGCAGCTCATGACCCTGGACCTGCCCACCGGGGTGGAGATTGAGATCAAGACC
GTAGGAGGTGGCCGGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ5SHN7
UniProtKB Entry NameRS10_THET8
GenBank Protein ID1022792
GenBank Gene IDU36504
General References
  1. Pfeiffer T, Jorcke D, Feltens R, Hartmann RK: Direct linkage of str-, S10- and spc-related gene clusters in Thermus thermophilus HB8, and sequences of ribosomal proteins L4 and S10. Gene. 1995 Dec 29;167(1-2):141-5. [PubMed:8566766]
  2. Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [PubMed:7957245]
  3. Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [PubMed:16287167]
  4. Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [PubMed:11014182]
  5. Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [PubMed:11007480]
  6. Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [PubMed:11163189]
  7. Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [PubMed:11014183]
  8. Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [PubMed:11511350]
  9. Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [PubMed:11296217]
  10. Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [PubMed:11228145]
  11. Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [PubMed:11283358]
  12. Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [PubMed:11340196]
  13. Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [PubMed:11866529]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01421Paromomycinapproved, investigationalyesinhibitorDetails
DB081852-METHYLTHIO-N6-ISOPENTENYL-ADENOSINE-5'-MONOPHOSPHATEexperimentalunknownDetails