Uncharacterized protein

Details

Name
Uncharacterized protein
Synonyms
Not Available
Gene Name
Not Available
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Amino acid sequence
>lcl|BSEQ0021998|Uncharacterized protein
MGRVYLVGAGPGDPELLTLKAYRLLKEAPVVLYDRLVDERVLALAPGEKVYVGKEEGESE
KQEEIHRLLLRHARAHPFVVRLKGGDPMVFGRGGEEVLFLLRHGVPVEVVPGVTSLLASG
LPLTHRGLAHGFAAVSGVLEGGGYPDLRPFARVPTLVVLMGVGRRVWIAKELLRLGRDPR
EPTLFVERASTPKERRVHARLEEVAEGKVEVRPPALWILGEVVRVFAEKEAPVDALALGG
Number of residues
240
Molecular Weight
26233.475
Theoretical pI
9.37
GO Classification
Functions
methyltransferase activity / precorrin-2 dehydrogenase activity
Processes
porphyrin-containing compound biosynthetic process
General Function
Precorrin-2 dehydrogenase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0021999|Uncharacterized protein
ATGGGTAGGGTCTACCTGGTGGGGGCGGGCCCCGGGGACCCGGAGCTTCTGACCCTCAAG
GCCTACCGCCTCCTCAAGGAGGCCCCCGTGGTCCTCTACGACCGGCTCGTGGACGAGAGG
GTCCTCGCCCTCGCCCCCGGGGAAAAGGTCTACGTGGGGAAGGAGGAGGGGGAAAGCGAA
AAGCAGGAGGAAATCCACCGCCTCCTCCTCCGCCACGCCCGGGCCCACCCCTTCGTGGTC
CGCCTCAAAGGGGGCGACCCCATGGTCTTCGGCCGGGGCGGGGAGGAGGTGCTCTTCCTC
CTCCGGCACGGCGTCCCCGTGGAGGTCGTCCCCGGGGTGACGAGCCTCCTCGCCTCCGGG
CTTCCCCTCACCCACCGGGGCCTCGCCCACGGCTTCGCCGCGGTCTCGGGGGTCTTGGAG
GGGGGAGGGTATCCGGACCTCAGGCCCTTCGCCCGGGTCCCCACCCTGGTGGTCCTCATG
GGGGTGGGGCGCCGGGTCTGGATCGCCAAGGAGCTCCTCCGCCTGGGGCGGGACCCCAGG
GAGCCCACCCTCTTCGTGGAGCGGGCCTCCACCCCCAAGGAGCGCCGGGTCCACGCCCGC
CTGGAAGAGGTGGCGGAAGGCAAGGTGGAGGTGCGTCCCCCCGCCCTCTGGATCCTGGGC
GAGGTGGTGCGCGTGTTCGCCGAGAAGGAAGCGCCTGTGGACGCCTTGGCCCTGGGAGGT
TAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ5SKH6
UniProtKB Entry NameQ5SKH6_THET8
GenBank Gene IDAP008226
General References
  1. Rehse PH, Kitao T, Tahirov TH: Structure of a closed-form uroporphyrinogen-III C-methyltransferase from Thermus thermophilus. Acta Crystallogr D Biol Crystallogr. 2005 Jul;61(Pt 7):913-9. Epub 2005 Jun 24. [PubMed:15983414]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails