ATP sulfurylase (Sulfate adenylyltransferase)

Details

Name
ATP sulfurylase (Sulfate adenylyltransferase)
Synonyms
  • Sulfate adenylyltransferase
Gene Name
Not Available
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Amino acid sequence
>lcl|BSEQ0022326|ATP sulfurylase (Sulfate adenylyltransferase)
MVETLPALEIGEDERLDLENLATGAFFPVKGFMTREEALSVAHEMRLPTGEVWTIPILLQ
FREKPRVGPGNTVALLHGGERVALLHVAEAYELDLEALARAVFGTDSETHPGVARLYGKG
PYALAGRVEVLKPRPRTPLEKTPEEVRAFFRQRGWRKVVAFQTRNAPHRAHEYLIRLGLE
LADGVLVHPILGAKKPDDFPTEVIVEAYQALIRDFLPQERVAFFGLATPMRYAGPKEAVF
HALVRKNFGATHFLVGRDHAGVGDFYDPYAAHRIFDRLPPLGIEIVKVGAVFHCPLCGGI
ASERTCPEGHREKRTAISMTKVRALLREGKAPPSELVRPELLPILRRGV
Number of residues
349
Molecular Weight
38837.68
Theoretical pI
8.78
GO Classification
Functions
metal ion binding / nucleotide binding / sulfate adenylyltransferase (ATP) activity
General Function
Sulfate adenylyltransferase (atp) activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0022327|ATP sulfurylase (Sulfate adenylyltransferase)
GTGGTGGAGACCCTTCCCGCTTTGGAGATCGGCGAGGACGAGAGGCTGGACCTGGAGAAC
CTGGCCACGGGGGCCTTCTTCCCCGTAAAGGGCTTCATGACCCGGGAGGAGGCCCTAAGC
GTGGCCCACGAGATGCGCCTCCCCACGGGGGAGGTCTGGACGATTCCCATCCTCCTCCAG
TTCCGGGAAAAACCCAGGGTAGGCCCAGGGAACACCGTGGCCCTCCTCCACGGGGGCGAA
CGGGTCGCCCTCCTCCACGTGGCCGAGGCCTACGAGCTGGACCTCGAGGCCCTGGCCCGG
GCCGTCTTCGGCACGGATAGCGAAACGCACCCCGGGGTGGCCCGCCTCTACGGCAAGGGC
CCCTACGCCCTGGCGGGCCGGGTGGAGGTCCTAAAGCCCAGGCCCCGCACCCCCCTGGAG
AAGACCCCGGAGGAGGTGCGGGCCTTCTTCCGGCAAAGGGGTTGGCGGAAGGTGGTGGCC
TTCCAGACGCGCAACGCCCCCCACCGGGCCCACGAGTACCTCATCCGGCTCGGCCTGGAG
CTTGCCGACGGGGTCCTCGTCCACCCCATCCTCGGGGCCAAGAAGCCAGACGACTTCCCC
ACGGAGGTCATCGTGGAGGCCTACCAGGCCCTGATCAGGGACTTCCTCCCCCAGGAGCGG
GTGGCCTTTTTCGGCCTCGCCACCCCCATGCGCTACGCCGGGCCCAAGGAGGCGGTCTTC
CACGCCCTGGTGCGCAAGAACTTCGGGGCCACCCACTTCCTGGTGGGCCGGGACCACGCC
GGGGTGGGGGACTTCTACGACCCCTACGCCGCCCACCGGATCTTTGACCGGCTTCCTCCC
TTAGGGATTGAGATCGTCAAGGTGGGGGCGGTCTTCCACTGCCCCCTCTGTGGCGGCATC
GCCTCGGAGAGGACCTGCCCCGAGGGCCACCGGGAGAAGCGCACGGCCATCAGCATGACC
AAGGTCCGGGCCCTCCTAAGGGAGGGAAAGGCCCCGCCTTCGGAGCTCGTCCGGCCGGAG
CTTTTGCCTATCCTCCGGCGGGGGGTCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ5SKH7
UniProtKB Entry NameQ5SKH7_THET8
GenBank Gene IDAP008226
General References
  1. Taguchi Y, Sugishima M, Fukuyama K: Crystal structure of a novel zinc-binding ATP sulfurylase from Thermus thermophilus HB8. Biochemistry. 2004 Apr 13;43(14):4111-8. [PubMed:15065853]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03708Adenosine 5'-phosphosulfateexperimental, investigationalunknownDetails