Multidrug resistance-associated protein 7

Details

Name
Multidrug resistance-associated protein 7
Synonyms
  • ATP-binding cassette sub-family C member 10
  • MRP7
  • SIMRP7
Gene Name
ABCC10
Organism
Humans
Amino acid sequence
>lcl|BSEQ0007017|Multidrug resistance-associated protein 7
MERLLAQLCGSSAAWPLPLWEGDTTGHCFTQLVLSALPHALLAVLSACYLGTPRSPDYIL
PCSPGWRLRLAASFLLSVFPLLDLLPVALPPGAGPGPIGLEVLAGCVAAVAWISHSLALW
VLAHSPHGHSRGPLALALVALLPAPALVLTVLWHCQRGTLLPPLLPGPMARLCLLILQLA
ALLAYALGWAAPGGPREPWAQEPLLPEDQEPEVAEDGESWLSRFSYAWLAPLLARGACGE
LRQPQDICRLPHRLQPTYLARVFQAHWQEGARLWRALYGAFGRCYLALGLLKLVGTMLGF
SGPLLLSLLVGFLEEGQEPLSHGLLYALGLAGGAVLGAVLQNQYGYEVYKVTLQARGAVL
NILYCKALQLGPSRPPTGEALNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQVG
VAFVGGLILALLLVPVNKVIATRIMASNQEMLQHKDARVKLVTELLSGIRVIKFCGWEQA
LGARVEACRARELGRLRVIKYLDAACVYLWAALPVVISIVIFITYVLMGHQLTATKVFTA
LALVRMLILPLNNFPWVINGLLEAKVSLDRIQLFLDLPNHNPQAYYSPDPPAEPSTVLEL
HGALFSWDPVGTSLETFISHLEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVR
GLSKGFGLATQEPWIQFATIRDNILFGKTFDAQLYKEVLEACALNDDLSILPAGDQTEVG
EKGVTLSGGQRARIALARAVYQEKELYLLDDPLAAVDADVANHLLHRCILGMLSYTTRLL
CTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQESDSATAQSVQNP
EKTKEGLEEEQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLLMQATRN
AADWWLSHWISQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPVFPLPKAAPNG
SSDIRFYLTVYATIAGVNSLCTLLRAVLFAAGTLQAAATLHRRLLHRVLMAPVTFFNATP
TGRILNRFSSDVACADDSLPFILNILLANAAGLLGLLAVLGSGLPWLLLLLPPLSIMYYH
VQRHYRASSRELRRLGSLTLSPLYSHLADTLAGLSVLRATGATYRFEEENLRLLELNQRC
QFATSATMQWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLSLSYALSLTGLLSG
LVSSFTQTEAMLVSVERLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLP
NALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDGVDTSQLELAQLR
SQLAIIPQEPFLFSGTVRENLDPQGLHKDRALWQALKQCHLSEVITSMGGLDGELGEGGR
SLSLGQRQLLCLARALLTDAKILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRL
NTILNSDRVLVLQAGRVVELDSPATLRNQPHSLFQQLLQSSQQGVPASLGGP
Number of residues
1492
Molecular Weight
161627.375
Theoretical pI
7.07
GO Classification
Functions
ATP binding / ATPase activity, coupled to transmembrane movement of substances
Processes
transmembrane transport
Components
integral component of membrane / lysosomal membrane / plasma membrane
General Function
Atpase activity, coupled to transmembrane movement of substances
Specific Function
ATP-dependent transporter probably involved in cellular detoxification through lipophilic anion extrusion.
Pfam Domain Function
Transmembrane Regions
32-52 70-90 102-122 133-153 172-192 293-313 320-340 391-411 414-434 507-527 538-558 875-895 933-953 974-994 1051-1071 1153-1173 1182-1202
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0019454|Multidrug resistance-associated protein 7 (ABCC10)
ATGGAACGACTTCTGGCCCAGCTGTGCGGCAGCAGCGCAGCGTGGCCGCTCCCGCTGTGG
GAGGGGGACACCACAGGCCACTGCTTCACCCAGCTGGTGCTCAGCGCCCTGCCCCACGCG
CTCCTCGCCGTGCTCAGTGCCTGTTACTTGGGCACCCCGAGGAGTCCAGATTACATCCTA
CCCTGCAGTCCTGGATGGCGCCTCCGACTTGCAGCTTCCTTCCTGCTTTCCGTCTTCCCG
CTGCTAGACCTTCTTCCAGTTGCTTTGCCACCAGGGGCAGGCCCAGGACCCATAGGGCTA
GAGGTGTTGGCAGGGTGCGTGGCAGCTGTGGCCTGGATCAGCCACAGCCTGGCCCTGTGG
GTGTTGGCACATTCCCCTCATGGCCACTCCCGGGGTCCCTTGGCCTTGGCCCTGGTAGCC
TTGCTGCCAGCTCCAGCCCTAGTGCTGACCGTGTTGTGGCATTGCCAGCGAGGCACACTT
CTGCCCCCACTTCTCCCAGGGCCCATGGCCCGCCTATGCTTGCTCATCCTGCAGCTGGCT
GCACTCTTGGCCTATGCACTGGGATGGGCAGCTCCTGGGGGACCACGAGAACCCTGGGCT
CAGGAGCCCCTCCTGCCCGAGGATCAAGAACCTGAGGTGGCTGAAGATGGGGAGAGTTGG
CTGTCACGCTTTTCCTATGCCTGGCTGGCACCCTTGCTGGCCCGTGGGGCCTGTGGAGAG
CTCCGGCAGCCTCAGGACATTTGCCGCCTCCCCCACAGACTGCAGCCAACCTACCTGGCT
CGTGTCTTCCAGGCACACTGGCAGGAGGGGGCACGGCTGTGGAGGGCCTTGTATGGGGCC
TTTGGACGGTGCTATCTGGCACTTGGACTGCTGAAGCTGGTGGGGACCATGTTGGGATTC
TCAGGGCCCCTGTTGCTCTCCCTACTGGTGGGCTTCCTGGAAGAGGGGCAGGAGCCACTA
AGCCACGGCCTGCTCTATGCTCTGGGGCTAGCCGGTGGGGCTGTGCTGGGTGCTGTGCTG
CAGAATCAGTATGGGTATGAGGTATATAAGGTAACACTTCAGGCACGGGGGGCTGTGCTG
AACATCCTGTACTGCAAGGCTTTACAGCTGGGGCCCAGCCGCCCTCCTACTGGGGAGGCC
CTGAACCTACTAGGCACTGACTCTGAACGGCTGCTTAACTTTGCTGGGAGCTTCCATGAA
GCCTGGGGCCTGCCCCTGCAACTGGCCATCACCCTCTACCTGCTGTACCAGCAGGTAGGC
GTGGCCTTCGTGGGTGGTCTCATCTTGGCACTGCTGCTGGTACCCGTCAACAAAGTGATT
GCCACCCGCATCATGGCCAGCAACCAGGAAATGCTACAGCACAAGGATGCGCGGGTTAAG
CTTGTGACAGAGCTGCTGAGTGGCATTCGGGTCATCAAGTTCTGCGGGTGGGAGCAGGCA
CTGGGAGCCCGAGTAGAGGCCTGCCGGGCTCGAGAGCTGGGGCGACTCCGGGTCATCAAA
TACCTGGATGCGGCCTGTGTATACCTGTGGGCTGCCCTACCGGTTGTCATCTCCATCGTT
ATCTTCATCACCTATGTCCTCATGGGGCACCAGCTCACTGCCACCAAGGTGTTCACGGCC
CTGGCACTGGTGCGAATGCTCATTCTTCCTCTCAACAACTTCCCTTGGGTGATCAATGGT
CTCCTGGAGGCCAAAGTGTCCTTGGACCGGATCCAGCTTTTCCTCGACCTTCCAAACCAC
AACCCCCAGGCCTACTACAGCCCAGATCCCCCTGCAGAGCCATCTACAGTATTGGAGCTG
CATGGAGCCTTGTTCTCCTGGGACCCAGTTGGAACCAGCCTGGAGACCTTCATCAGTCAT
CTCGAAGTGAAAAAGGGTATGCTGGTGGGCATCGTGGGGAAGGTCGGCTGTGGGAAGAGC
TCCCTGCTGGCTGCCATCGCTGGAGAGCTCCACAGGCTGCGTGGGCATGTGGCAGTGCGG
GGGCTGTCCAAGGGCTTTGGCCTGGCCACCCAGGAACCCTGGATCCAGTTTGCCACCATC
CGAGACAACATCCTCTTTGGGAAGACATTTGATGCACAGCTGTACAAGGAGGTGCTAGAA
GCCTGCGCCCTCAATGATGACCTCAGTATCCTGCCTGCTGGAGACCAGACAGAGGTGGGG
GAGAAGGGTGTCACCCTTAGCGGAGGACAGCGTGCCCGGATTGCCCTTGCTCGTGCTGTC
TACCAGGAAAAGGAGCTCTATCTCCTCGATGACCCTCTGGCCGCTGTGGATGCAGATGTG
GCCAACCACCTGCTGCACAGGTGCATCCTGGGCATGCTGAGCTACACCACACGGCTGCTC
TGCACCCACCGCACTGAGTACCTGGAGAGGGCTGACGCGGTGCTGCTGATGGAGGCCGGG
CGCCTCATCCGGGCTGGACCTCCCTCTGAGATTCTGCCACTGGTACAAGCTGTCCCCAAA
GCCTGGGCTGAGAATGGACAAGAGTCTGACTCAGCCACAGCCCAGTCAGTACAGAACCCA
GAGAAAACAAAGGAGGGGCTGGAGGAGGAGCAGAGCACATCTGGTCGCCTGCTGCAGGAA
GAAAGCAAGAAGGAGGGCGCCGTGGCCTTGCACGTGTACCAAGCTTACTGGAAGGCCGTG
GGCCAGGGCTTGGCCTTAGCCATCCTCTTCTCTCTGCTTCTCATGCAAGCCACGCGGAAC
GCTGCTGACTGGTGGCTCTCCCACTGGATCTCTCAGCTGAAGGCTGAGAATAGCTCCCAG
GAGGCGCAACCCTCCACCAGCCCAGCTTCTATGGGGCTCTTCTCTCCGCAGCTGCTCCTC
TTTTCCCCTGGAAACCTCTACATCCCAGTGTTCCCACTGCCCAAAGCTGCCCCCAATGGC
TCCTCAGACATCCGTTTCTACCTCACCGTGTATGCGACCATTGCTGGTGTAAATTCCCTC
TGCACCCTTCTCCGGGCAGTGCTCTTTGCAGCAGGCACCCTTCAAGCAGCTGCCACTCTG
CATCGCCGCCTGCTGCATCGAGTCCTTATGGCACCAGTGACTTTCTTCAATGCCACACCC
ACGGGCCGGATCCTAAACCGCTTCTCCTCTGATGTGGCCTGTGCGGATGACAGCCTGCCC
TTCATCCTCAACATCCTCCTGGCCAACGCGGCAGGCCTGCTGGGGCTCCTGGCCGTGCTG
GGCTCTGGCCTGCCCTGGCTGCTGCTCCTGCTGCCGCCTTTGAGCATCATGTACTATCAC
GTGCAGCGCCACTACAGGGCCTCCTCACGGGAGCTGCGGCGCCTGGGCAGCCTCACCCTG
TCTCCACTGTATAGCCATCTGGCCGATACCTTGGCTGGCCTCTCTGTGCTCCGGGCCACA
GGGGCCACCTACAGGTTTGAGGAGGAGAACCTGCGACTCCTTGAGCTAAACCAGAGGTGC
CAGTTTGCCACCAGTGCCACAATGCAGTGGCTGGACATTCGGCTACAGCTCATGGGGGCG
GCAGTGGTCAGCGCTATCGCAGGCATCGCTCTGGTGCAGCACCAGCAGGGCCTCGCTAAC
CCAGGGCTGGTGGGCTTGTCGCTGTCTTATGCCCTGTCCCTGACGGGCCTGCTCTCGGGC
CTGGTGAGCAGCTTCACACAGACAGAGGCCATGCTGGTGAGCGTCGAGCGGCTGGAAGAG
TACACCTGTGACCTGCCCCAGGAACCCCAGGGCCAGCCACTGCAGCTGGGCACCGGCTGG
CTGACCCAGGGGGGCGTGGAGTTCCAGGACGTGGTGTTGGCGTACCGGCCAGGGCTGCCG
AATGCCCTGGATGGAGTGACCTTCTGCGTGCAGCCTGGAGAGAAGTTGGGCATCGTGGGC
CGCACAGGCTCCGGCAAGTCTTCCCTGTTGTTGGTGCTCTTCCGGCTGCTAGAGCCCAGT
TCAGGGCGAGTGCTGCTGGACGGCGTGGACACCAGCCAGCTGGAGCTGGCCCAGCTCAGA
TCCCAGTTGGCTATCATCCCCCAGGAGCCCTTTTTGTTCAGTGGGACTGTTCGGGAAAAC
CTGGACCCCCAGGGCCTACATAAGGACAGGGCCTTGTGGCAGGCCCTGAAGCAGTGCCAC
CTGAGTGAGGTGATTACATCCATGGGTGGTCTGGATGGTGAGCTGGGTGAGGGGGGCCGG
AGCTTATCTCTTGGGCAGAGGCAGCTGTTGTGTTTGGCCAGGGCTCTCCTCACAGATGCC
AAGATCCTGTGTATCGATGAGGCCACAGCAAGTGTGGACCAGAAGACAGACCAGCTGCTC
CAGCAGACCATCTGCAAACGCTTTGCCAACAAGACAGTGCTGACCATTGCCCATAGGCTC
AACACGATCCTGAACTCAGACCGGGTGCTGGTGCTACAAGCGGGGAGAGTGGTAGAGCTG
GACTCCCCGGCCACCCTGCGCAACCAGCCCCACTCCCTGTTCCAGCAGCTGCTGCAGAGC
AGCCAGCAGGGAGTCCCTGCCTCACTCGGAGGTCCCTGA
Chromosome Location
6
Locus
6p21.1
External Identifiers
ResourceLink
UniProtKB IDQ5T3U5
UniProtKB Entry NameMRP7_HUMAN
GenBank Protein ID21103955
GenBank Gene IDAY032599
HGNC IDHGNC:52
General References
  1. Kao HH, Chang MS, Cheng JF, Huang JD: Genomic structure, gene expression, and promoter analysis of human multidrug resistance-associated protein 7. J Biomed Sci. 2003 Jan-Feb;10(1):98-110. [PubMed:12566991]
  2. Hattori A, Okumura K, Nagase T, Kikuno R, Hirosawa M, Ohara O: Characterization of long cDNA clones from human adult spleen. DNA Res. 2000 Dec 31;7(6):357-66. [PubMed:11214971]
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]
  5. Chen ZS, Hopper-Borge E, Belinsky MG, Shchaveleva I, Kotova E, Kruh GD: Characterization of the transport properties of human multidrug resistance protein 7 (MRP7, ABCC10). Mol Pharmacol. 2003 Feb;63(2):351-8. [PubMed:12527806]
  6. Hopper-Borge E, Chen ZS, Shchaveleva I, Belinsky MG, Kruh GD: Analysis of the drug resistance profile of multidrug resistance protein 7 (ABCC10): resistance to docetaxel. Cancer Res. 2004 Jul 15;64(14):4927-30. [PubMed:15256465]
  7. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00541Vincristineapproved, investigationalunknownsubstrateinhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateinhibitorDetails
DB04348Taurocholic AcidexperimentalunknowninhibitorDetails
DB00203Sildenafilapproved, investigationalunknowninhibitorDetails
DB00563MethotrexateapprovedunknowninhibitorDetails
DB00773EtoposideapprovedunknownsubstrateinhibitorDetails
DB00997Doxorubicinapproved, investigationalunknowninhibitorDetails
DB00091Ciclosporinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB00987Cytarabineapproved, investigationalunknownsubstrateDetails
DB00694DaunorubicinapprovedunknownsubstrateDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateDetails
DB00441GemcitabineapprovedunknownsubstrateDetails
DB00300Tenofovir disoproxilapproved, investigationalunknownsubstrateDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknowninhibitorDetails