2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2

Details

Name
2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2
Synonyms
  • 1.14.11.-
Gene Name
OGFOD2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037175|2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2
MATVGAPRHFCRCACFCTDNLYVARYGLHVRFRGEQQLRRDYGPILRSRGCVSAKDFQQL
LAELEQEVERRQRLGQESAARKALIASSYHPARPEVYDSLQDAALAPEFLAVTEYSVSPD
ADLKGLLQRLETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDMPKGRPNTMNNYGVLL
HELGLDEPLMTPLRERFLQPLMALLYPDCGGGRLDSHRAFVVKYAPGQDLELGCHYDNAE
LTLNVALGKVFTGGALYFGGLFQAPTALTEPLEVEHVVGQGVLHRGGQLHGARPLGTGER
WNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCALT
Number of residues
350
Molecular Weight
38996.065
Theoretical pI
5.44
GO Classification
Functions
dioxygenase activity / iron ion binding / L-ascorbic acid binding / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
General Function
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0016710|2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (OGFOD2)
ATGGCGACGGTGGGGGCTCCGCGGCACTTCTGCCGCTGCGCCTGCTTCTGCACCGATAAC
TTGTACGTGGCGCGCTATGGGCTGCACGTGCGCTTCCGAGGCGAGCAGCAGCTGCGCCGG
GACTACGGCCCGATCCTGCGCAGCCGAGGCTGTGTTAGCGCCAAGGACTTCCAGCAGCTG
TTAGCAGAGCTTGAGCAGGAGGTGGAGCGGCGGCAGCGGCTGGGGCAGGAGTCAGCAGCT
AGGAAAGCCCTCATCGCGAGTTCCTACCACCCGGCACGGCCTGAGGTCTACGACTCACTG
CAGGATGCAGCTCTGGCCCCCGAGTTCCTGGCCGTGACTGAGTACAGCGTGTCCCCAGAC
GCAGACCTCAAGGGCCTTCTCCAGCGGCTGGAGACAGTATCGGAGGAGAAGCGCATCTAC
CGGGTGCCTGTTTTCACAGCGCCCTTCTGCCAGGCCCTGCTGGAAGAGCTGGAGCACTTC
GAGCAATCGGACATGCCTAAGGGGAGGCCCAACACCATGAACAACTACGGGGTGCTGCTG
CACGAGCTCGGGCTGGACGAGCCGCTGATGACACCACTGCGGGAGCGCTTCCTGCAGCCG
CTGATGGCCCTGCTGTACCCTGACTGTGGCGGGGGCCGGCTCGACAGCCACCGGGCCTTT
GTGGTCAAATACGCACCGGGCCAGGACCTGGAGCTGGGCTGCCACTATGATAATGCCGAG
CTCACCCTCAATGTGGCCTTGGGCAAGGTCTTCACAGGGGGCGCCCTGTATTTTGGGGGC
CTCTTCCAGGCACCCACAGCCCTGACGGAGCCCCTGGAGGTGGAGCACGTGGTGGGCCAG
GGTGTCCTCCACCGTGGCGGCCAGCTGCATGGAGCCCGGCCCTTGGGCACTGGTGAGCGT
TGGAACCTTGTCGTCTGGCTCCGAGCCTCTGCTGTGCGCAACAGCCTCTGTCCCATGTGC
TGCCGTGAGCCCGACCTGGTGGACGATGAGGGCTTCGGTGATGGCTTCACCCGAGAGGAG
CCCGCCACGGTGGATGTATGTGCGCTCACCTGA
Chromosome Location
12
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ6N063
UniProtKB Entry NameOGFD2_HUMAN
GenBank Protein ID34364724
GenBank Gene IDBX640675
GenAtlas IDOGFOD2
HGNC IDHGNC:25823
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00126Ascorbic acidapproved, nutraceuticalunknownDetails