Arylacetamide deacetylase-like 2

Details

Name
Arylacetamide deacetylase-like 2
Synonyms
  • 3.1.1.-
Gene Name
AADACL2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037272|Arylacetamide deacetylase-like 2
MGLKALCLGLLCVLFVSHFYTPMPDNIEESWKIMALDAIAKTCTFTAMCFENMRIMRYEE
FISMIFRLDYTQPLSDEYITVTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSS
KQRAFDFLNRWTANTLDAVVVGVDYRLAPQHHFPAQFEDGLAAVKFFLLEKILTKYGVDP
TRICIAGDSSGGNLATAVTQQVQNDAEIKHKIKMQVLLYPGLQITDSYLPSHRENEHGIV
LTRDVAIKLVSLYFTKDEALPWAMRRNQHMPLESRHLFKFVNWSILLPEKYRKDYVYTEP
ILGGLSYSLPGLTDSRALPLLANDSQLQNLPLTYILTCQHDLLRDDGLMYVTRLRNVGVQ
VVHEHIEDGIHGALSFMTSPFYLRLGLRIRDMYVSWLDKNL
Number of residues
401
Molecular Weight
46099.02
Theoretical pI
7.16
GO Classification
Functions
carboxylic ester hydrolase activity
Components
extracellular region / integral component of membrane
General Function
Carboxylic ester hydrolase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0017330|Arylacetamide deacetylase-like 2 (AADACL2)
ATGGGGCTAAAAGCTCTCTGTTTGGGGCTGCTTTGTGTTCTTTTTGTCTCTCATTTTTAC
ACACCCATGCCAGACAACATTGAAGAAAGCTGGAAAATAATGGCCTTGGATGCCATCGCT
AAAACTTGTACATTTACGGCTATGTGTTTTGAAAATATGCGTATTATGAGATATGAAGAG
TTTATATCCATGATATTCAGGCTGGATTATACCCAACCACTTTCAGATGAATACATCACA
GTGACTGATACAACATTTGTTGACATTCCAGTACGATTGTACTTGCCAAAAAGAAAGTCA
GAAACCCGAAGGCGAGCTGTGATATATTTTCATGGTGGTGGTTTTTGTTTTGGAAGTTCC
AAACAGAGGGCTTTTGACTTCCTGAATAGATGGACGGCAAACACGCTTGATGCTGTTGTT
GTAGGCGTGGACTATAGGCTGGCTCCTCAACACCACTTTCCTGCTCAGTTTGAAGATGGC
CTTGCTGCAGTCAAATTTTTTCTTTTGGAAAAAATTCTTACAAAATATGGAGTGGATCCC
ACCCGAATCTGCATTGCGGGAGACAGTTCTGGGGGCAATTTAGCAACAGCGGTCACTCAA
CAGGTGCAGAATGATGCTGAAATAAAACATAAAATCAAGATGCAAGTCTTACTTTACCCT
GGCTTACAGATAACAGATTCTTATTTGCCATCTCACCGAGAAAATGAGCATGGTATAGTT
TTGACCAGGGATGTAGCCATAAAACTCGTGAGCTTATATTTCACCAAGGATGAAGCACTT
CCCTGGGCAATGAGAAGAAACCAACACATGCCTCTGGAGTCAAGACATCTGTTTAAGTTT
GTTAACTGGAGTATTCTTCTTCCTGAGAAGTATAGAAAAGACTATGTATATACTGAACCA
ATTCTTGGAGGACTTAGTTATTCATTGCCAGGACTTACAGACAGCAGAGCATTACCCTTG
TTGGCCAATGATTCTCAGTTACAGAATTTGCCACTAACCTATATTCTTACTTGTCAACAT
GATCTCTTAAGAGATGATGGACTTATGTATGTTACAAGACTTCGAAATGTTGGAGTCCAA
GTTGTTCATGAACATATTGAGGATGGAATTCATGGAGCTTTATCATTCATGACTTCACCA
TTTTATTTACGTCTAGGTCTTAGGATAAGAGATATGTATGTAAGTTGGCTGGATAAGAAT
TTATAA
Chromosome Location
3
Locus
3q25.1
External Identifiers
ResourceLink
UniProtKB IDQ6P093
UniProtKB Entry NameADCL2_HUMAN
GenBank Protein ID57997503
GenBank Gene IDBX647585
HGNC IDHGNC:24427
General References
  1. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]
  2. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB07814Gibberellic acidexperimentalunknownDetails
DB07815GIBBERELLIN A4experimentalunknownDetails