Sodium-driven chloride bicarbonate exchanger

Details

Name
Sodium-driven chloride bicarbonate exchanger
Synonyms
  • NCBE
  • Solute carrier family 4 member 10
Gene Name
SLC4A10
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009600|Sodium-driven chloride bicarbonate exchanger
MEIKDQGAQMEPLLPTRNDEEAVVDRGGTRSILKTHFEKEDLEGHRTLFIGVHVPLGGRK
SHRRHRHRGHKHRKRDRERDSGLEDGRESPSFDTPSQRVQFILGTEDDDEEHIPHDLFTE
LDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVL
LDMHANTLEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQHHHQNQKKLTNRIPIVRSFA
DIGKKQSEPNSMDKNAGQVVSPQSAPACVENKNDVSRENSTVDFSKGLGGQQKGHTSPCG
MKQRHEKGPPHQQEREVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQG
LAEVPIPTRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEF
LDQVTVLPPGEWDPSIRIEPPKNVPSQEKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTG
RIFGGLILDIKRKAPYFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRIS
AIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLW
TATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSEAYPINMHNDLE
LLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLTVSECKSLHGEYVGRACGHDHP
YVPDVLFWSVILFFSTVTLSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIG
IPSPKLQVPSVFKPTRDDRGWFVTPLGPNPWWTVIAAIIPALLCTILIFMDQQITAVIIN
RKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQ
PKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQFFDRIK
LFWMPAKHQPDFIYLRHVPLRKVHLFTIIQMSCLGLLWIIKVSRAAIVFPMMVLALVFVR
KLMDLLFTKRELSWLDDLMPESKKKKLEDAEKEEEQSMLAMEDEGTVQLPLEGHYRDDPS
VINISDEMSKTALWRNLLITADNSKDKESSFPSKSSPS
Number of residues
1118
Molecular Weight
125945.115
Theoretical pI
Not Available
GO Classification
Functions
inorganic anion exchanger activity / sodium
Processes
anion transmembrane transport / bicarbonate transport / brain morphogenesis / chloride transport / hydrogen ion transmembrane transport / ion transport / locomotory exploration behavior / multicellular organism growth / post-embryonic development / pyramidal neuron development / regulation of intracellular pH / response to light stimulus / sodium ion transmembrane transport / transmembrane transport
Components
apical dendrite / basilar dendrite / basolateral plasma membrane / CA3 pyramidal cell dendrite / integral component of membrane / integral component of plasma membrane / neuronal cell body / plasma membrane
General Function
Sodium:bicarbonate symporter activity
Specific Function
Electrogenic sodium/bicarbonate cotransporter in exchange for intracellular chloride. Plays an important role in regulating intracellular pH (By similarity).
Pfam Domain Function
Transmembrane Regions
510-530 539-559 563-583 597-617 627-647 721-741 763-783 810-830 856-876 913-933 936-956 999-1019
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0013259|Sodium-driven chloride bicarbonate exchanger (SLC4A10)
ATGGAGATTAAAGACCAGGGAGCCCAAATGGAGCCGCTGCTGCCTACGAGAAATGATGAA
GAAGCAGTTGTGGATAGAGGTGGAACTCGTTCTATTCTCAAAACACACTTTGAGAAAGAA
GATTTAGAAGGTCATCGAACACTATTTATTGGAGTACATGTGCCCTTGGGAGGAAGAAAA
AGCCATCGACGTCACAGGCATCGTGGTCATAAACACAGAAAGAGAGACAGAGAAAGAGAT
TCAGGATTAGAGGATGGAAGGGAGTCACCTTCTTTTGACACCCCATCACAGAGGGTACAG
TTTATTCTTGGAACCGAGGATGATGACGAGGAACACATTCCTCATGACCTTTTCACAGAA
CTGGATGAGATTTGTTGGCGTGAAGGTGAGGACGCTGAGTGGCGAGAAACAGCCAGGTGG
TTGAAGTTTGAAGAAGATGTGGAAGATGGAGGAGAAAGGTGGAGCAAGCCTTATGTGGCT
ACTCTTTCATTGCACAGCTTGTTTGAATTGAGAAGTTGTATTCTGAATGGAACTGTGTTG
CTGGACATGCATGCCAACACTTTAGAAGAAATTGCAGATATGGTTCTTGACCAACAAGTG
AGCTCAGGTCAGCTGAATGAAGATGTACGCCATAGGGTCCATGAGGCATTGATGAAACAG
CATCATCATCAGAATCAGAAAAAACTCACCAACAGGATTCCCATTGTTCGTTCCTTTGCT
GATATTGGCAAGAAACAGTCAGAACCAAATTCCATGGACAAAAATGCAGGTCAGGTTGTT
TCTCCTCAGTCTGCTCCAGCCTGTGTTGAAAATAAAAATGATGTTAGCAGAGAAAACAGC
ACTGTTGACTTTAGCAAGGGACTGGGAGGCCAACAAAAGGGGCATACTAGTCCATGTGGG
ATGAAACAAAGGCATGAAAAAGGACCTCCACACCAGCAAGAGAGAGAGGTTGATCTGCAT
TTTATGAAAAAGATTCCTCCAGGTGCTGAAGCATCGAACATCTTAGTGGGAGAACTGGAG
TTCTTGGATCGAACAGTAGTTGCGTTTGTCAGGTTGTCTCCAGCTGTATTGCTTCAAGGA
CTGGCTGAAGTCCCAATCCCAACCAGATTTTTGTTCATTCTTCTGGGACCCCTGGGAAAG
GGTCAACAGTACCATGAGATTGGCAGATCAATTGCAACCCTAATGACAGATGAGGTATTT
CATGATGTTGCCTATAAAGCTAAAGATCGTAATGACTTGGTATCAGGAATTGATGAGTTT
CTGGATCAGGTTACTGTTCTCCCTCCTGGAGAATGGGATCCAAGCATTCGAATAGAGCCT
CCCAAAAATGTTCCTTCCCAGGAGAAGAGGAAGATTCCTGCTGTACCAAATGGAACAGCA
GCTCATGGGGAAGCAGAGCCCCACGGAGGACATAGTGGACCTGAACTCCAGCGAACTGGA
AGGATTTTTGGGGGACTTATTTTAGATATCAAAAGAAAAGCTCCATACTTCTGGAGTGAC
TTCAGAGATGCTTTCAGCCTGCAGTGCTTAGCATCTTTTCTATTTCTCTACTGCGCGTGT
ATGTCTCCTGTCATCACGTTTGGAGGACTGCTGGGAGAAGCAACTGAAGGGCGTATAAGT
GCAATTGAATCTCTCTTTGGAGCATCCATGACCGGGATAGCCTATTCTCTCTTTGGTGGA
CAGCCTCTTACCATATTAGGCAGTACAGGACCAGTTTTGGTGTTTGAAAAGATTTTGTTT
AAATTTTGCAAAGAATATGGGCTGTCATACCTATCTTTAAGAGCTAGCATTGGACTTTGG
ACTGCAACTCTATGTATCATACTTGTGGCCACAGATGCTAGTTCCCTTGTCTGCTACATC
ACTCGGTTTACTGAAGAAGCTTTTGCTTCCCTGATTTGCATCATTTTCATTTATGAGGCC
CTGGAGAAGTTGTTTGAACTCAGTGAAGCATATCCAATCAACATGCATAATGATCTGGAA
CTGCTGACACAATACTCGTGTAACTGTGTGGAACCGCATAATCCCAGCAATGGCACATTG
AAGGAATGGAGGGAATCCAATATTTCTGCCTCTGACATAATTTGGGAGAACCTAACTGTG
TCAGAATGCAAATCATTGCATGGAGAGTATGTTGGACGGGCCTGTGGCCATGATCACCCA
TATGTTCCAGATGTTCTATTTTGGTCTGTGATCCTGTTCTTTTCCACAGTTACTCTGTCA
GCCACCCTGAAGCAGTTCAAGACTAGCAGATATTTTCCAACCAAGGTTCGATCCATAGTG
AGTGACTTTGCTGTCTTTCTTACAATTCTGTGTATGGTTTTAATTGACTATGCCATTGGG
ATCCCATCTCCAAAACTACAAGTACCAAGTGTTTTCAAGCCCACTAGAGATGATCGTGGC
TGGTTTGTTACGCCTTTAGGTCCAAACCCATGGTGGACAGTAATAGCTGCTATAATTCCA
GCTCTGCTTTGTACTATTCTAATTTTTATGGACCAACAGATTACAGCTGTCATCATCAAC
AGGAAAGAGCATAAGCTAAAGAAAGGTTGTGGGTACCATCTGGACCTATTAATGGTGGCT
GTCATGCTCGGTGTATGCTCCATCATGGGCCTGCCATGGTTTGTGGCTGCCACAGTCCTC
TCCATCACTCATGTCAATAGCCTAAAACTGGAATCAGAATGCTCAGCTCCAGGAGAACAA
CCCAAATTTCTCGGCATTCGGGAGCAAAGGGTTACTGGGCTTATGATTTTTATTCTTATG
GGTTCATCAGTCTTTATGACCAGTATTCTGAAGTTTATTCCCATGCCAGTGCTATATGGA
GTGTTTCTTTATATGGGTGCTTCATCTCTAAAGGGAATTCAGTTCTTTGATAGGATAAAG
CTCTTCTGGATGCCGGCAAAACATCAACCAGATTTTATATACCTAAGGCACGTACCGCTT
CGAAAAGTGCATCTCTTCACAATTATTCAGATGAGTTGCCTTGGCCTTTTGTGGATAATA
AAAGTTTCAAGAGCTGCTATTGTCTTTCCCATGATGGTGTTAGCCCTGGTATTTGTAAGA
AAGTTGATGGACTTGTTGTTCACGAAGCGGGAACTCAGCTGGTTGGATGATTTGATGCCC
GAGAGTAAGAAAAAGAAACTGGAAGATGCTGAAAAAGAAGAAGAACAAAGTATGCTAGCT
ATGGAAGATGAGGGCACAGTACAACTCCCATTGGAAGGGCACTATAGAGATGATCCATCT
GTGATCAATATATCTGATGAAATGTCAAAGACTGCCTTGTGGAGGAACCTTCTGATTACT
GCCGATAACTCAAAAGATAAGGAGTCAAGCTTTCCTTCCAAAAGCTCCCCTTCCTAA
Chromosome Location
2
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ6U841
UniProtKB Entry NameS4A10_HUMAN
HGNC IDHGNC:13811
General References
  1. Wang CZ, Yano H, Nagashima K, Seino S: The Na+-driven Cl-/HCO3- exchanger. Cloning, tissue distribution, and functional characterization. J Biol Chem. 2000 Nov 10;275(45):35486-90. [PubMed:10993873]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01390Sodium bicarbonateapprovedunknownsubstrateDetails